Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate WP_086509351.1 BZY95_RS07630 succinyl-diaminopimelate desuccinylase
Query= BRENDA::Q9KQ52 (377 letters) >NCBI__GCF_002151265.1:WP_086509351.1 Length = 390 Score = 476 bits (1224), Expect = e-139 Identities = 234/373 (62%), Positives = 280/373 (75%), Gaps = 1/373 (0%) Query: 4 SPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQSPLF 63 SP L LA ELI R SVTP D GCQ LMIERL+ LGF IE + F D NFWA G P+ Sbjct: 10 SPTLQLAMELIRRPSVTPDDLGCQALMIERLERLGFHIERLPFGDVENFWATHGHHGPVL 69 Query: 64 VFAGHTDVVPAGPLSQWHTPPFEPTVID-GFLHGRGAADMKGSLACMIVAVERFIAEHPD 122 FAGHTDVVP+GP + W PPFEP + D G L GRG+ADMKGSLA MI AVERF+ HPD Sbjct: 70 AFAGHTDVVPSGPHTYWEYPPFEPCIDDDGMLRGRGSADMKGSLAAMITAVERFVTAHPD 129 Query: 123 HQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRGS 182 H G I FLITSDEEGP ++GT VVE L R+E +D CIVGEPSST +GDV+KNGRRGS Sbjct: 130 HHGRIAFLITSDEEGPAVDGTRAVVEHLRERHERLDYCIVGEPSSTDVLGDVIKNGRRGS 189 Query: 183 ITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAGT 242 + G L +KG QGHVAYPHLA NP+H+A+PAL L WD GNA+FP TSFQI N++AGT Sbjct: 190 LGGVLHIKGIQGHVAYPHLARNPIHQAMPALDALVREHWDSGNAFFPATSFQISNIRAGT 249 Query: 243 GASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGEL 302 GA+NVIPG+ +V FNFRFSTE+T E+++ R ++LDAHGL+Y + WTL+G+PFLT GEL Sbjct: 250 GATNVIPGDVEVVFNFRFSTEVTHEQLRERTQAILDAHGLEYQLDWTLNGEPFLTAEGEL 309 Query: 303 LAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADLE 362 + A + VE V + P L T+GGTSDGRFIA +G+QVVELGP NATIH+ NE VR ADL+ Sbjct: 310 VDAALHGVEAVLGRRPKLSTSGGTSDGRFIATLGSQVVELGPRNATIHQTNERVRAADLD 369 Query: 363 KLTDMYQKTLNHL 375 L+ +Y+ L L Sbjct: 370 DLSRIYEAILGKL 382 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 509 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 390 Length adjustment: 30 Effective length of query: 347 Effective length of database: 360 Effective search space: 124920 Effective search space used: 124920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_086509351.1 BZY95_RS07630 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.27306.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-168 546.8 0.0 1.4e-168 546.6 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086509351.1 BZY95_RS07630 succinyl-diaminopi Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086509351.1 BZY95_RS07630 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 546.6 0.0 1.4e-168 1.4e-168 2 370 .] 13 382 .. 12 382 .. 0.99 Alignments for each domain: == domain 1 score: 546.6 bits; conditional E-value: 1.4e-168 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaG 70 l+la+eLi+r+svtP+d g+q+l++erL++lgf+ie+l f+d++n+wat+g + pvl+faGhtDvvP+G lcl|NCBI__GCF_002151265.1:WP_086509351.1 13 LQLAMELIRRPSVTPDDLGCQALMIERLERLGFHIERLPFGDVENFWATHGHHGPVLAFAGHTDVVPSG 81 5899***************************************************************** PP TIGR01246 71 elekWssdpfepee.rdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGt 138 ++ W+ +pfep + dG+l grG+aDmkgslaa+++a+erfv++++dh+G++++litsDeeg a+dGt lcl|NCBI__GCF_002151265.1:WP_086509351.1 82 PHTYWEYPPFEPCIdDDGMLRGRGSADMKGSLAAMITAVERFVTAHPDHHGRIAFLITSDEEGPAVDGT 150 ************87258**************************************************** PP TIGR01246 139 kkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpv 207 ++vve l+er+e +dy++vgePss++ lGDvik+GrrGs+ g l+ikGiqGhvaYPh+a+nP+h+a+p+ lcl|NCBI__GCF_002151265.1:WP_086509351.1 151 RAVVEHLRERHERLDYCIVGEPSSTDVLGDVIKNGRRGSLGGVLHIKGIQGHVAYPHLARNPIHQAMPA 219 ********************************************************************* PP TIGR01246 208 lkeliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhk 276 l +l+ +++D+Gn+ffp++s+qi+ni+agtga+nviPg+++v fn+rfs+ev++e+l+++ ++ild+h+ lcl|NCBI__GCF_002151265.1:WP_086509351.1 220 LDALVREHWDSGNAFFPATSFQISNIRAGTGATNVIPGDVEVVFNFRFSTEVTHEQLRERTQAILDAHG 288 ********************************************************************* PP TIGR01246 277 ldYelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtih 345 l+Y+l+w+l gepflt eg+l++++ + +e vl+++p+lstsGGtsD+rfia+lg++vvelG+ n+tih lcl|NCBI__GCF_002151265.1:WP_086509351.1 289 LEYQLDWTLNGEPFLTAEGELVDAALHGVEAVLGRRPKLSTSGGTSDGRFIATLGSQVVELGPRNATIH 357 ********************************************************************* PP TIGR01246 346 kvneavkiedleklsevyeklleel 370 + ne+v+ +dl+ ls++ye +l +l lcl|NCBI__GCF_002151265.1:WP_086509351.1 358 QTNERVRAADLDDLSRIYEAILGKL 382 ********************99765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.02 # Mc/sec: 6.05 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory