Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (uncharacterized)
to candidate WP_086511529.1 BZY95_RS19380 amidohydrolase
Query= curated2:Q04FS2 (382 letters) >NCBI__GCF_002151265.1:WP_086511529.1 Length = 435 Score = 143 bits (360), Expect = 1e-38 Identities = 94/264 (35%), Positives = 132/264 (50%), Gaps = 17/264 (6%) Query: 5 EQLIKIRRHLHANPEIGMQEVKTHQFLLEQIAKFPQENLTIETISEIPTALLVRIAGSDP 64 +++ + R LH PE+ QE KT L E + E+L E + +V + + Sbjct: 24 DEVQALYRQLHRYPELPFQEHKTSARLAEAL-----ESLGFEVTRGVGGTGVVALLRNGE 78 Query: 65 KRTIALRTDMDALPIQEETGLDFASKNDH---------VMHACGHDIHMTVALGILSYFA 115 T+ LR DMDALPI+E TGL+FAS+ +MHACGHD+H + +G A Sbjct: 79 GPTVMLRGDMDALPIEERTGLEFASRESAENAQGERVPLMHACGHDLHSSCVVGAAGVMA 138 Query: 116 KHQPKDN--LLVFFQPAEENEFGGKRFYDAGGFQGEYLPDEFYALHVNPQLPAGQIASRK 173 + N L++ QPAEE G + D G ++ PD H P L AG + Sbjct: 139 ALREHWNGTLMLICQPAEEIFGGARAMLDDGLYERFARPDVVLGQHNMPAL-AGTVGHIA 197 Query: 174 GTLFAGSNELRISFIGKSGHAAYPQNAKDSIVAAANFVTNVQTVVSRNVDPIEGGVVTIG 233 G A L ++ G GH + P D +V AA+ VT +QT+V+R V P E VVT+G Sbjct: 198 GRAMAACTNLAVTIHGAGGHGSMPAQTVDPVVIAAHVVTRLQTIVAREVPPEETVVVTVG 257 Query: 234 KFNAGKAMNIIAGKADIEGTIRSF 257 K AG NII A++E +RSF Sbjct: 258 KLQAGTQANIIPHSAELEINVRSF 281 Lambda K H 0.320 0.137 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 435 Length adjustment: 31 Effective length of query: 351 Effective length of database: 404 Effective search space: 141804 Effective search space used: 141804 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory