Align Probable N-acetyl-LL-diaminopimelate aminotransferase; Putative aminotransferase A; EC 2.6.1.- (characterized)
to candidate WP_086510442.1 BZY95_RS13490 aminotransferase class V-fold PLP-dependent enzyme
Query= SwissProt::P16524 (393 letters) >NCBI__GCF_002151265.1:WP_086510442.1 Length = 386 Score = 188 bits (478), Expect = 2e-52 Identities = 128/365 (35%), Positives = 192/365 (52%), Gaps = 12/365 (3%) Query: 25 AQHEDVISLTIGQPDFFTPHHVKAAAKKAIDENVTSYTPNAGYLELRQAVQLYMKKKADF 84 A DVI L +G+PDF TP V AA + A+ +T Y+P AG LR+A+ + + Sbjct: 27 AAGHDVIHLEVGEPDFATPEPVVAAGQAALAAGLTRYSPAAGLPALREAIAGHYGEHFGA 86 Query: 85 NYDAESEIIITTGASQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAKPVIVDTT- 143 + D +++T GAS A+ A + ++ PGD V+M P YP + L GA+ VDT Sbjct: 87 DVDPR-RVLVTPGASGALLLASQLLVGPGDRVLMADPNYPCNRHFMALAGAE---VDTVP 142 Query: 144 ---SHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIAALLKGRNVFVLSD 200 G++L A L+ T+ +L PSNPTG L +LK++A + R +L D Sbjct: 143 IGPQSGWQLDANLVARHWQDATRLAMLATPSNPTGHMLDAAQLKAVADTVAARGGHLLVD 202 Query: 201 EIYSELTYDRPHYSIATYLRDQTIVINGLSKSHSMTGWRIGFLFAPKDIAKHILKVHQYN 260 EIY L+YD S+A+ D V+N SK MTGWR+G+L AP+ + + ++ Q Sbjct: 203 EIYQGLSYDIAPLSVASLTAD-AFVVNSFSKYFGMTGWRLGWLLAPQAAVEPLTRLAQNV 261 Query: 261 VSCASSISQKAALEAVTNGFDDAL-IMREQYKKRLDYVYDRLVSMGL-DVVKPSGAFYIF 318 A + +Q AAL A T L R + +R D + L +GL + P GAFY++ Sbjct: 262 FLAAPTPAQHAALAAFTPECRALLEARRSELGRRRDALLAGLARLGLAPSLPPQGAFYLW 321 Query: 319 PSIKSFGMTSFDFSMALLEDAGVALVPGSSFS-TYGEGYVRLSFACSMDTLREGLDRLEL 377 I + S F LLE+ VA+ PG F+ T GE +VR++F ++ L E + RLE Sbjct: 322 LDISRYSRDSQAFCQRLLEEENVAITPGIDFAVTGGEYHVRIAFTTGIERLEEAVSRLER 381 Query: 378 FVLKK 382 F+ ++ Sbjct: 382 FLARQ 386 Lambda K H 0.319 0.135 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 24 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 393 Length of database: 386 Length adjustment: 30 Effective length of query: 363 Effective length of database: 356 Effective search space: 129228 Effective search space used: 129228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory