Align homoisocitrate dehydrogenase (EC 1.1.1.87) (characterized)
to candidate WP_086511787.1 BZY95_RS20735 tartrate dehydrogenase
Query= BRENDA::Q5SIJ1 (334 letters) >NCBI__GCF_002151265.1:WP_086511787.1 Length = 357 Score = 220 bits (560), Expect = 5e-62 Identities = 138/354 (38%), Positives = 200/354 (56%), Gaps = 26/354 (7%) Query: 1 MAYRICLIEGDGIGHEVIPAARRVLEATG----LPLEFVEAE-AGWETFERRGTSVPEET 55 M +RI +I GDGIG+EV+P RVLEA + L F + A + + + G +P++ Sbjct: 1 MTHRIAVIPGDGIGNEVMPEGLRVLEAVAKRFDIDLAFEHFDFACCDYYAKHGKMMPDDW 60 Query: 56 VEKILSCHATLFGAATSPTRKVP---GFFGAIRYLRRRLDLYANVRPAK-----SRPVPG 107 E++ A +GA P VP +G++ RR+ D Y N+RP K P+ Sbjct: 61 FEQLKDFDAIFYGAVGWPDT-VPDHVSLWGSLLQFRRQFDQYINLRPCKLLPGIKSPLAD 119 Query: 108 SRPG-VDLVIVRENTEGLYVEQ-----ERRYLDVAIADAVISKKASERIGRAALRIAEGR 161 +PG +D +VRENTEG Y E +V I + V+++ ++R+ + A +A+ R Sbjct: 120 RKPGDIDFYVVRENTEGEYSSVGGKMFEGTEREVVIQETVMTRHGTDRVLKFAFELAQSR 179 Query: 162 PRKTLHIAHKANVLPLTQGLFLDTVKEVAKDFPLVNVQDIIVDNCAMQLVMRPERFDVIV 221 PRK L A K+N + +T + + V ++ ++P V+V +D VM P+ FDV+V Sbjct: 180 PRKKLTSATKSNGIAITMPWWDERVVAMSGNYPEVSVDKFHIDILTANFVMHPDWFDVVV 239 Query: 222 TTNLLGDILSDLAAGLVGGLGLAPSGNI---GDTTAVFEPVHGSAPDIAGKGIANPTAAI 278 +NL GDILSDL G +G+APS NI G ++FEPVHGSAPDIAGKGIANP I Sbjct: 240 ASNLFGDILSDLGPACTGTIGVAPSANINPEGKFPSLFEPVHGSAPDIAGKGIANPIGQI 299 Query: 279 LSAAMMLDYLGEKEAAKRVEKAVDLVLER---GPRTPDLGGDATTEAFTEAVVE 329 S A+ML++LG KEAAK + A + VLE TPD+ G TT+ +A+ E Sbjct: 300 WSGALMLEHLGHKEAAKAIVDAFEAVLEEANPAVLTPDIRGQGTTQTLGKAIAE 353 Lambda K H 0.319 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 325 Number of extensions: 16 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 357 Length adjustment: 29 Effective length of query: 305 Effective length of database: 328 Effective search space: 100040 Effective search space used: 100040 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory