Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate WP_086508150.1 BZY95_RS01045 aspartate aminotransferase family protein
Query= SwissProt::Q88FI7 (416 letters) >NCBI__GCF_002151265.1:WP_086508150.1 Length = 404 Score = 189 bits (479), Expect = 2e-52 Identities = 132/403 (32%), Positives = 202/403 (50%), Gaps = 38/403 (9%) Query: 21 GRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPHGPYLAL 80 G + +WD +G+ YIDF GGI V +LGHC+P +V+A+ Q +L H + N + P L L Sbjct: 28 GEGSRLWDQEGREYIDFAGGIAVNSLGHCHPVLVKALTEQGNKLWHLS-NVYTNEPSLKL 86 Query: 81 MEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARG------ATGKRAIIAFDGGFHGRTL 134 + L V ++ +SG EA E ALK+AR K I++F FHGRT Sbjct: 87 AKTL---VERTFADKAYFCSSGGEANEAALKLARRWAHDNFGEHKHRIVSFYQSFHGRTF 143 Query: 135 ATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAVEDVAAF 194 T+++ G+ Y Q G +PG + H + + D+ +L +D A Sbjct: 144 FTVSVGGQ-PKYSQGFGPVPGGIVHGEFNNLDS---------------VRDLINDDTCAV 187 Query: 195 IFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRLGIEPDL 254 + EP+QGEGG F Q LR CD L+I DE+Q+G GRTG +A+ GIEPD+ Sbjct: 188 MVEPMQGEGGITPATQEFLQGLRDLCDAHDALLIFDEVQTGVGRTGSLYAYMEYGIEPDI 247 Query: 255 LLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQMTDENLATW 314 L AK++ GG P+GA++ + AL G G TY GN ++ A ALA++ + D Sbjct: 248 LTSAKALGGGFPIGAMLTTDRVAPALAIGTHGSTYGGNALASAVALAAVEHI-DTPEVLG 306 Query: 315 GERQEQAIVSRYERWKASGLSPYIGR-LTGVGAMRGIEFANADGSPAPAQLAK-VMEAAR 372 G +Q + E +A + R + G+G + G E +P AK ++ A Sbjct: 307 GVKQRHDLFR--EHLEAINRKHGVFREIRGMGLLIGAEM-----TPEYKDRAKDILPLAI 359 Query: 373 ARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLAEL 415 GL+ + +G +++R+ L I + EG+ LE+ + L Sbjct: 360 EEGLMALIAGP--NVLRMAPSLVIPEADIAEGMARLERAIERL 400 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 404 Length adjustment: 31 Effective length of query: 385 Effective length of database: 373 Effective search space: 143605 Effective search space used: 143605 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory