Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate WP_086510803.1 BZY95_RS15480 4-aminobutyrate--2-oxoglutarate transaminase
Query= SwissProt::Q88FI7 (416 letters) >NCBI__GCF_002151265.1:WP_086510803.1 Length = 430 Score = 347 bits (889), Expect = e-100 Identities = 179/395 (45%), Positives = 244/395 (61%), Gaps = 4/395 (1%) Query: 23 NAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPHGPYLALME 82 NA +WD DG R IDF GGIGVLN+GH +P VVEA++AQ ++ H P+ Y+ + E Sbjct: 31 NALIWDADGNRIIDFAGGIGVLNIGHRHPKVVEAVKAQLDKVMHTCQTVMPYEGYVKVAE 90 Query: 83 QLSQFVPVSYPLAGMLTNSGAEAAENALKVARGATGKRAIIAFDGGFHGRTLATLNLNGK 142 +LSQ PV ML NSGAEA ENA+K+AR ATGK +I FDGG+HGRT T+ +NGK Sbjct: 91 KLSQVTPVRGHAKVMLANSGAEALENAVKIARAATGKNNVICFDGGYHGRTFMTMAMNGK 150 Query: 143 VAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAVEDVAAFIFEPVQGE 202 VAPY G +PG V+ PYP GV+ ++A++ + + D AA + EPV GE Sbjct: 151 VAPYASDFGTMPGNVFRAPYPVPYHGVSEDEAIRGLKMAIKTDANPRDTAAIVLEPVLGE 210 Query: 203 GGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRLGIEPDLLLLAKSIA 262 GGF +F +A+R CDE G+L+I+DE+QSGFGRTG+ FA G+EPD++ +AKS+A Sbjct: 211 GGFYPAPASFLKAIREICDEHGMLMIVDEVQSGFGRTGKLFAIEHSGVEPDIITMAKSMA 270 Query: 263 GGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQMTDENLATWGERQEQAI 322 GMP+ AVVG ++M A LGGTY+GNP+SCAA LA L +EN+ + Sbjct: 271 DGMPISAVVGTDKVMDASGPNSLGGTYTGNPLSCAATLAVLDVFEEENILEKSMALGDKL 330 Query: 323 VSRYERWKASGLSPYIGRLTGVGAMRGIEFA--NADGSPAPAQLAKVMEAARARGLLLMP 380 R+ +W+ + +GAM ++ A +P A + + AR +GL+L+ Sbjct: 331 AKRFAQWQRD--FDCVDNARNMGAMAALDLVTDKAKHTPDADLAAALCKKAREKGLILLS 388 Query: 381 SGKARHIIRLLAPLTIEAEVLEEGLDILEQCLAEL 415 G + IR L P+TIE E+LEEGLDI+E L EL Sbjct: 389 CGLYGNTIRFLMPVTIEDEILEEGLDIVEAALTEL 423 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 537 Number of extensions: 30 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 430 Length adjustment: 32 Effective length of query: 384 Effective length of database: 398 Effective search space: 152832 Effective search space used: 152832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory