Align Homoaconitase large subunit; HACN; Homoaconitate hydratase; EC 4.2.1.36 (characterized)
to candidate WP_086508286.1 BZY95_RS01750 aconitate hydratase
Query= SwissProt::Q9ZNE0 (418 letters) >NCBI__GCF_002151265.1:WP_086508286.1 Length = 656 Score = 193 bits (491), Expect = 1e-53 Identities = 143/422 (33%), Positives = 210/422 (49%), Gaps = 16/422 (3%) Query: 1 MGQTLAEKIL-SHKVGRPVRAGELVVVEVDQVMVVDSIAGSFFKRLEYLEATPRYPERVS 59 M LA++++ H V + G + + +DQ ++ D + LE + R + S Sbjct: 1 MPLNLAQQLIRDHLVDGEMTPGSEIALRIDQALLQDVLGTLVMLELEAM-GLDRVKTQPS 59 Query: 60 I-VIDHVAPAANLEVAKAQKEIREWGKRHGIRVFDVGRGVCHQVLIEEGLAQPGWVVVGS 118 + IDH A+ A+ ++ +R G+ G G+ H V +E PG +VG Sbjct: 60 VQYIDHGLVQADNLNAETYLFLKSACERFGVWYSGPGNGISHPVHMEH-FGIPGQSIVGC 118 Query: 119 DSHSTTYGAVGAFGTGMGATDIALAAASGRTWLRVPESVKVVFRGRLPKGVTAKDAALEM 178 DSH+T G++G G G ++A+A A +L +PE + G LP V+AKDA LE+ Sbjct: 119 DSHTTAAGSLGMLAIGAGGIEVAMAMAGEPLYLSMPEIWGIRLAGSLPDWVSAKDAVLEL 178 Query: 179 VRLLTAEGATYMAVEIHLLDGAEALTRGERMTLANLTVEAGAKAGLVVPSGEILEMY--- 235 +R GA +E H G L+ +R LAN+ E GA A V PS E + Sbjct: 179 LRRHGVAGAKNTIIEYHG-PGLANLSAMDRHVLANMGTEMGATA-TVFPSDEEARRFLAA 236 Query: 236 --RVPDW--LYPDPDARYAKEVEIDLSALTPRVSVPFYVDNVHEVAQVKGKRVDQVFIGT 291 R DW L +P Y +E +DLS+L P +++P D V V +V G+ + Q +IG+ Sbjct: 237 RGREADWKPLAAEPGCTYDREEVLDLSSLEPLIALPSSPDKVVPVREVVGEPLHQAYIGS 296 Query: 292 CTNGRIEDLRAAAEVLRGRKVAPWVRLLVVPASSQVLEEAARDGTLLTLLEAGATIGTPG 351 N D AE++RGR VA V L + P+S QVL RDG L L+ +GA + G Sbjct: 297 SGNPGYRDFAVVAEMVRGRTVADGVSLDINPSSRQVLATLIRDGYLADLVASGARLHQTG 356 Query: 352 CGPCMGRHMG-VLAPGEVCVSTSNRNFRGRMGAPDAEIYLASPRVAAASAVAGYLTTPEE 410 C C+G MG A G + T RNF GR G + ++L SP AAASA+AG + P Sbjct: 357 CNGCIG--MGQAPAVGRNSLRTVPRNFPGRSGTREDSVFLCSPETAAASALAGSIADPRS 414 Query: 411 LE 412 L+ Sbjct: 415 LD 416 Lambda K H 0.318 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 602 Number of extensions: 36 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 656 Length adjustment: 35 Effective length of query: 383 Effective length of database: 621 Effective search space: 237843 Effective search space used: 237843 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory