Align Homoserine O-acetyltransferase; HAT; EC 2.3.1.31; Homoserine transacetylase; HTA (uncharacterized)
to candidate WP_086510438.1 BZY95_RS13465 homoserine O-acetyltransferase
Query= curated2:Q1QQD3 (399 letters) >NCBI__GCF_002151265.1:WP_086510438.1 Length = 385 Score = 400 bits (1028), Expect = e-116 Identities = 199/372 (53%), Positives = 254/372 (68%), Gaps = 4/372 (1%) Query: 24 TSQVAMFAGDQPLPLDCGIDLAPFQIAYQTYGELNAGKSNAILVCHALTGDQHVANVHPV 83 T Q A F D PL L CG L + + Y+TYG LNA +SNA+L+CHAL+G H A H Sbjct: 13 TPQTAHF--DDPLALACGRTLPAYDLVYETYGTLNAERSNAVLICHALSGHHHAAGYHDA 70 Query: 84 TG-KPGWWVTLVGPGKPLDTDKYFVICSNVIGGCMGSTGPASTNPATGTVWGLDFPVITI 142 KPGWW +GPGK +DT+++FV+ N +GGC GSTGP STNPATG WG DFP++T+ Sbjct: 71 DERKPGWWDAHIGPGKSIDTNRFFVVSLNNLGGCHGSTGPISTNPATGRQWGPDFPMVTV 130 Query: 143 PDMVRAQAMLIDRLGIDTLFSVVGGSMGGMQVLQWCVAYPQRVFSALPIACSTRHSAQNI 202 D V +QA L DRLGI+ + +GGS+GGMQVLQW YP+RV +A+ IA + + SAQNI Sbjct: 131 SDWVHSQARLADRLGIERFAAAIGGSLGGMQVLQWTRLYPERVANAVIIAATPKLSAQNI 190 Query: 203 AFHELGRQAVMADPDWRDGRYVEQGTYPHRGLGVARMAAHITYLSDAALHRKFGRRMQDR 262 AF+E+ RQA+ +DPD+ DG Y E GT P RGL +ARM HITYLS+ A+ KFGR ++ Sbjct: 191 AFNEVARQAIRSDPDFHDGWYAEHGTAPRRGLKLARMVGHITYLSEDAMGSKFGRDLRSE 250 Query: 263 DLPTFSFDADFQVESYLRHQGSSFVERFDANSYLYLTRAMDYFDIAADHNGVLAAAFRDT 322 DL F +D +FQVESYLR+QG +F FDAN+YL +T+A+DYFD AA+H GVLA A Sbjct: 251 DL-NFGYDVEFQVESYLRYQGDTFSTAFDANTYLLMTKALDYFDPAAEHGGVLAEAVAPC 309 Query: 323 RTRFCVVSFTSDWLFPTSESRATVHALNAGGARVSFAEIETDRGHDAFLLDLPEFFDIAH 382 + F VVSFTSDW FP S SR +AL G RVS+ I++ GHDAFLL P + + Sbjct: 310 QGPFLVVSFTSDWRFPPSRSRELANALIRAGKRVSYVNIDSPHGHDAFLLPEPRYQAVFA 369 Query: 383 AFLVSAGKTRGL 394 AF+ + GL Sbjct: 370 AFMSRVARELGL 381 Lambda K H 0.323 0.136 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 500 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 399 Length of database: 385 Length adjustment: 31 Effective length of query: 368 Effective length of database: 354 Effective search space: 130272 Effective search space used: 130272 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
Align candidate WP_086510438.1 BZY95_RS13465 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.5207.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-145 468.2 0.0 9.8e-145 468.0 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086510438.1 BZY95_RS13465 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086510438.1 BZY95_RS13465 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 468.0 0.0 9.8e-145 9.8e-145 3 350 .. 21 372 .. 19 373 .. 0.98 Alignments for each domain: == domain 1 score: 468.0 bits; conditional E-value: 9.8e-145 TIGR01392 3 eeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgrald 69 ++l l +G +l+ ++++y+tyGtlnaer+Navl+cHal+g++h+ag++d++++ GWWd +Gpg+++d lcl|NCBI__GCF_002151265.1:WP_086510438.1 21 DPLALACGRTLPAYDLVYETYGTLNAERSNAVLICHALSGHHHAAGYHDADERkpGWWDAHIGPGKSID 89 789*********************************************9888789************** PP TIGR01392 70 tsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlG 138 t+r+fvv+lN+lG+c+GstgP+s+np+tg+++g++fP+vt+ D+v+ q++l+d+Lg+e++aa +GgSlG lcl|NCBI__GCF_002151265.1:WP_086510438.1 90 TNRFFVVSLNNLGGCHGSTGPISTNPATGRQWGPDFPMVTVSDWVHSQARLADRLGIERFAAAIGGSLG 158 ********************************************************************* PP TIGR01392 139 GmqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARm 206 Gmq+l+w+ yperv ++v +a+++++saq+iafnev+rqai+sDp+++dG+yae++ +P++GL+lARm lcl|NCBI__GCF_002151265.1:WP_086510438.1 159 GMQVLQWTRLYPERVANAVIIAATPKLSAQNIAFNEVARQAIRSDPDFHDGWYAEHGtAPRRGLKLARM 227 *********************************************************9*********** PP TIGR01392 207 lalltYrseesleerfgreakseeslassleeefsvesylryqgkkfverFdAnsYllltkaldthdla 275 ++++tY+se+++ ++fgr+ +se +l++ ++ ef+vesylryqg++f + FdAn+Yll+tkald++d a lcl|NCBI__GCF_002151265.1:WP_086510438.1 228 VGHITYLSEDAMGSKFGRDLRSE-DLNFGYDVEFQVESYLRYQGDTFSTAFDANTYLLMTKALDYFDPA 295 *******************9998.88999**************************************** PP TIGR01392 276 rgrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekv 342 +++ + l+ea++ ++ p+lvv+++sD++f++++++ela+al +a+++ y++i+s++GHDaFll + ++ lcl|NCBI__GCF_002151265.1:WP_086510438.1 296 AEHGGVLAEAVAPCQGPFLVVSFTSDWRFPPSRSRELANALIRAGKRvsYVNIDSPHGHDAFLLPEPRY 364 ******************************************9999999******************99 PP TIGR01392 343 eelirefl 350 +++ ++f+ lcl|NCBI__GCF_002151265.1:WP_086510438.1 365 QAVFAAFM 372 99988886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (385 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.85 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory