Align O-acetylhomoserine sulfhydrylase (EC:2.5.1.49) (characterized)
to candidate WP_086510355.1 BZY95_RS13035 methionine gamma-lyase
Query= reanno::Korea:Ga0059261_3194 (402 letters) >NCBI__GCF_002151265.1:WP_086510355.1 Length = 415 Score = 300 bits (769), Expect = 4e-86 Identities = 173/384 (45%), Positives = 239/384 (62%), Gaps = 4/384 (1%) Query: 18 ATQAIRGG-TARSEWGETSEALFLTSGYAYDCAGDAAARFSGDQQGMTYSRLQNPTVEML 76 AT+AI +R E G + + LTS + ++ A RF+G+ G YSR+ NPTV L Sbjct: 28 ATRAIHAAYDSRDEQGALTPPMHLTSTFTFESVEQGAERFAGEAPGHFYSRISNPTVATL 87 Query: 77 EQRIALLEGAEACRATASGMAAMTAALLCQLSAGDHLIGGRAAFGSCRWLTDTQLPKFGI 136 EQR+A LEGAEA ATASGM A+TA + L GD LI +G L +FGI Sbjct: 88 EQRMANLEGAEAGLATASGMGAITALMWSLLRPGDELITDSHLYGCTHAFFHHGLTEFGI 147 Query: 137 ETTVVDARDPQQFIDAIRPNTKVFFFETPANPTMDVVDLKAVCAIARERGIVTVVDNAFA 196 VD P AI TK+ +FETPANPTM +VD++AV IA G VVDN +A Sbjct: 148 RVKHVDLSQPAALEVAIGERTKLVYFETPANPTMRLVDIEAVSRIAHRHGARVVVDNTYA 207 Query: 197 TPALQRPMDFGADVVAYSATKMMDGQGRVLAGAVCGTEEFINNTLLPFHRN-TGPTLSPF 255 TP + RP++ GAD V +SATK + G G ++AG + G+ + I+ L ++ TG +SPF Sbjct: 208 TPVITRPIEQGADFVVHSATKYLGGHGDLIAGVLVGSVDDIHRVRLTGLKDFTGAVMSPF 267 Query: 256 NAWVVLKGLETLDLRIQRQSENALKVARFLEGR--VPRVNFPGLPSHPQHNLAMSQMAAA 313 A+++++GL+TL++R+QRQS +AL+VAR+LE V RV++PGL S PQH LA QM+ Sbjct: 268 TAFLIMRGLKTLEIRMQRQSASALEVARWLERHPAVERVHYPGLTSFPQHELARRQMSDY 327 Query: 314 GPIFSIELDGGRTQAHGLLDALGLIDISNNIGDSRSLMTHPASTTHSGVAEDQRLLMGVG 373 G I + EL GG ++ L LI + ++GD+ SL+ HPAS THS ++ ++R G+ Sbjct: 328 GGIIAFELAGGLEAGRRFMNRLELIQRAVSLGDAESLIQHPASMTHSVLSPEERAEHGIS 387 Query: 374 EGMLRLNVGLEDPEDLIADLDQAL 397 E ++RL+VGLE P DL ADL QAL Sbjct: 388 ETLIRLSVGLETPSDLRADLAQAL 411 Lambda K H 0.319 0.134 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 397 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 402 Length of database: 415 Length adjustment: 31 Effective length of query: 371 Effective length of database: 384 Effective search space: 142464 Effective search space used: 142464 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory