Alignments for a candidate for cmutase in Halomonas desiderata SP1

GapMind for Amino acid biosynthesis

Alignments for a candidate for cmutase in Halomonas desiderata SP1

Align chorismate mutase (EC 5.4.99.5) (characterized)
to candidate WP_086511287.1 BZY95_RS18095 gamma subclass chorismate mutase AroQ

Query= BRENDA::Q2SY64
         (202 letters)



>NCBI__GCF_002151265.1:WP_086511287.1
          Length = 197

 Score = 95.9 bits (237), Expect = 4e-25
 Identities = 61/141 (43%), Positives = 73/141 (51%), Gaps = 4/141 (2%)

Query: 10  LRASLVAALLGCAALSAPRIAAADGDDTALTNLVALASQRLALAEPVAHWKWINRKPISD 69
           L  +LV  L GC           D D  A+  ++ L  +RL +A  VA  KW +  PI  
Sbjct: 15  LAIALVLLLAGCQTQPPE---PPDEDKAAIDRMLVLIDERLDVAPLVAQSKWNSGAPIEA 71

Query: 70  PPREAALLTDVEKRATANGVDPAYARTFFDDQIAASKQLQNALFATW-RATHGPEGPAPD 128
           P REA +L  V + A A GVD A+AR FFD Q  ASKQ+Q  L   W +    P    PD
Sbjct: 72  PEREAQILDQVAEDAEAAGVDDAFARRFFDKQFEASKQIQRRLHHQWLQEGRSPFADPPD 131

Query: 129 LATSTRPQLDRLTQSLIAALA 149
           LA   RP LDRLT  LI ALA
Sbjct: 132 LAEEVRPVLDRLTPQLIEALA 152


Lambda     K      H
   0.318    0.128    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 122
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 202
Length of database: 197
Length adjustment: 21
Effective length of query: 181
Effective length of database: 176
Effective search space:    31856
Effective search space used:    31856
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)

Align candidate WP_086511287.1 BZY95_RS18095 (gamma subclass chorismate mutase AroQ)
to HMM TIGR01806 (putative chorismate mutase (EC 5.4.99.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01806.hmm
# target sequence database:        /tmp/gapView.12569.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01806  [M=114]
Accession:   TIGR01806
Description: CM_mono2: putative chorismate mutase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                 Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                 -----------
    5.2e-32   96.6   0.3    6.7e-32   96.2   0.3    1.1  1  lcl|NCBI__GCF_002151265.1:WP_086511287.1  BZY95_RS18095 gamma subclass cho


Domain annotation for each sequence (and alignments):
>> lcl|NCBI__GCF_002151265.1:WP_086511287.1  BZY95_RS18095 gamma subclass chorismate mutase AroQ
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !   96.2   0.3   6.7e-32   6.7e-32       3     114 .]      38     151 ..      36     151 .. 0.96

  Alignments for each domain:
  == domain 1  score: 96.2 bits;  conditional E-value: 6.7e-32
                                 TIGR01806   3 saaldqlvdlaneRleladaValyKaesnlpieDsereeqvLdslraqaksagldedsverlfqaqinA 71 
                                               +aa+d+++ l++eRl +a  Va++K++s+ pie +ere+q+Ld+++++a++ag+d+  ++r+f+ q +A
  lcl|NCBI__GCF_002151265.1:WP_086511287.1  38 KAAIDRMLVLIDERLDVAPLVAQSKWNSGAPIEAPEREAQILDQVAEDAEAAGVDDAFARRFFDKQFEA 106
                                               56899**************************************************************** PP

                                 TIGR01806  72 nkaiqyrllsdWk.skaeppvevrdLe.dlRakidqlntelLeal 114
                                               +k iq rl  +W+ + ++p  +++dL  ++R+ +d l+ +l+eal
  lcl|NCBI__GCF_002151265.1:WP_086511287.1 107 SKQIQRRLHHQWLqEGRSPFADPPDLAeEVRPVLDRLTPQLIEAL 151
                                               *************777788889****99**************986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (114 nodes)
Target sequences:                          1  (197 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 8.27
//
[ok]

This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.

Downloads

Candidates (tab-delimited)
Steps (tab-delimited)
Rules (tab-delimited)
Protein sequences (fasta format)
Organisms (tab-delimited)
SQLite3 databases

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
HMMer finds a hit (regardless of coverage or other bits).

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

our ignorance of proteins' functions,
omissions in the gene models,
frame-shift errors in the genome sequence, or
the organism lacks the pathway.

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

the paper from 2019 on GapMind for amino acid biosynthesis
the paper from 2022 on GapMind for carbon sources
the source code
instructions for running GapMind on your computer
changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory

GapMind for Amino acid biosynthesis