Align amino-acid N-acetyltransferase (EC 2.3.1.1) (characterized)
to candidate WP_086509236.1 BZY95_RS06985 amino-acid N-acetyltransferase
Query= BRENDA::P22567 (432 letters) >NCBI__GCF_002151265.1:WP_086509236.1 Length = 437 Score = 409 bits (1052), Expect = e-119 Identities = 210/430 (48%), Positives = 283/430 (65%), Gaps = 1/430 (0%) Query: 4 YVNWLRHASPYINSHRDRTFVVMLPGEGVEHPNFGNIVHDLVLLHSLGARLVLVHGSRPQ 63 +V+W R++SPYIN+HR RTFV+++ GE + ++ DL LLH+LG RLV+V G RPQ Sbjct: 7 FVDWFRNSSPYINAHRGRTFVILIEGEAMARGRGEQLIQDLALLHTLGVRLVVVFGIRPQ 66 Query: 64 IEARLAARGLAPRYHRDLRVTDAPTLECVIDAVGSLRIAIEARLSMDMAASPMQGARLRV 123 +E L G+ PR H V D + CV R+ +EAR S+ + +P+ G L Sbjct: 67 VEQALNEAGIVPRRHNGRWVADEAIMACVERVAAEQRLWLEARFSLGLPNTPLHGVELTA 126 Query: 124 AGGNLVTARPIGVVEGVDYHHTGEVRRIDRKGIGRLLDERSIVLLSPLGYSPTGEIFNLA 183 GNLV A+P+GV EG+DY H+GEVRR+ + LLD S+VLL PLG+S TGE+F+L Sbjct: 127 VSGNLVMAKPLGVREGIDYDHSGEVRRVRVSAVQGLLDRGSLVLLPPLGFSSTGEVFDLD 186 Query: 184 CEDVAMRAAIDLEAEKLILYGAEQGLLDASGKLVRELRPQQV-PAHLQRLGNSYQAELLD 242 +VA AA+ L A+KLIL G E GL D +G L R+L P + P Q S QA + Sbjct: 187 AAEVAQHAAMALAADKLILMGEEPGLYDENGALQRQLSPDEAEPLLSQAEPGSEQARHIA 246 Query: 243 AAAQACRAGVKRSHIVSYTEDGALLSELFTRTGNGTLVAQEQFEQLREAGIEDVGGLIEL 302 AA A R GV R+H++S+ + ALL ELFTR G GT++ + ++EQLR A + D+GGL+EL Sbjct: 247 AACAAARHGVARTHLLSWHDHDALLGELFTRDGVGTMITRHRYEQLRPAELGDIGGLLEL 306 Query: 303 IRPLEEQGILVRRSREVLEREIEQFSIVEREGLIIACAALYPIADSEAGELACLAVNPEY 362 + PLE +G+LV RSRE LE EI+ + ++ER+G+II CAAL+ A+++ GELACLA++ Y Sbjct: 307 LEPLERRGMLVPRSRERLEHEIDDYLVIERDGMIIGCAALHRFAEADMGELACLAIHVGY 366 Query: 363 RHGGRGDELLERIEERARGLGLKTLFVLTTRTAHWFRERGFQPSSVERLPAARASLYNFQ 422 R G RG LL IE RAR LGL +LFVLTT TAHWF E GF+PS +E LP + YN Sbjct: 367 RGGARGSLLLSGIERRARRLGLASLFVLTTHTAHWFVEHGFRPSDIESLPPLKRDTYNHA 426 Query: 423 RNSQVFEKSL 432 R S++ K L Sbjct: 427 RKSKILVKPL 436 Lambda K H 0.321 0.138 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 580 Number of extensions: 30 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 432 Length of database: 437 Length adjustment: 32 Effective length of query: 400 Effective length of database: 405 Effective search space: 162000 Effective search space used: 162000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_086509236.1 BZY95_RS06985 (amino-acid N-acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.1335.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.5e-161 521.6 0.0 9.6e-161 521.4 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086509236.1 BZY95_RS06985 amino-acid N-acety Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086509236.1 BZY95_RS06985 amino-acid N-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 521.4 0.0 9.6e-161 9.6e-161 1 429 [] 7 436 .. 7 436 .. 0.99 Alignments for each domain: == domain 1 score: 521.4 bits; conditional E-value: 9.6e-161 TIGR01890 1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrg 69 fv+w+r+++Pyinahr++t+v+ ++ge+++ + ++l++d+allh+lGvrlv+v G rpq+e+ l++ g lcl|NCBI__GCF_002151265.1:WP_086509236.1 7 FVDWFRNSSPYINAHRGRTFVILIEGEAMARGRGEQLIQDLALLHTLGVRLVVVFGIRPQVEQALNEAG 75 8******************************************************************** PP TIGR01890 70 rtthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvd 138 + ++ ++G v+dea + +v+ +a e rl +ear+s l+ntp g +l+ vsGn+v+a+P+Gv eG+d lcl|NCBI__GCF_002151265.1:WP_086509236.1 76 IVPRRHNGRWVADEAIMACVERVAAEQRLWLEARFSLGLPNTPLHGVELTAVSGNLVMAKPLGVREGID 144 ********************************************************************* PP TIGR01890 139 yehtGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGil 207 y h+Gevr++ + +++ lld +s+vll+Plgfs tGe+f+l++ +va ++a++l adklil++ee+G+ lcl|NCBI__GCF_002151265.1:WP_086509236.1 145 YDHSGEVRRVRVSAVQGLLDRGSLVLLPPLGFSSTGEVFDLDAAEVAQHAAMALAADKLILMGEEPGLY 213 ********************************************************************* PP TIGR01890 208 dadGklvaelsaqeveslverleeet.tarllsaavkalrgGvarshlvsyaedGallqelftrdGiGt 275 d++G l+++ls++e+e+l+ ++e + +ar + aa +a r Gvar+hl+s+ all elftrdG+Gt lcl|NCBI__GCF_002151265.1:WP_086509236.1 214 DENGALQRQLSPDEAEPLLSQAEPGSeQARHIAAACAAARHGVARTHLLSWHDHDALLGELFTRDGVGT 282 *********************99876689**************************************** PP TIGR01890 276 lvskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaalypyae 344 +++++ +e++r a+++d+gg+lel++Ple G+lv+rsre le+ei+++ vie+dG+iigcaal+ +ae lcl|NCBI__GCF_002151265.1:WP_086509236.1 283 MITRHRYEQLRPAELGDIGGLLELLEPLERRGMLVPRSRERLEHEIDDYLVIERDGMIIGCAALHRFAE 351 ********************************************************************* PP TIGR01890 345 eevgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPearr 413 +++gelacla++ +r+g rG ll+ ie rar +Gl lfvltt+t+hWf e+Gf ++++++lP +r lcl|NCBI__GCF_002151265.1:WP_086509236.1 352 ADMGELACLAIHVGYRGGARGSLLLSGIERRARRLGLASLFVLTTHTAHWFVEHGFRPSDIESLPPLKR 420 ********************************************************************* PP TIGR01890 414 klynyqrrskilvkkl 429 yn+ r+skilvk+l lcl|NCBI__GCF_002151265.1:WP_086509236.1 421 DTYNHARKSKILVKPL 436 *************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (437 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 12.14 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory