Align Ornithine cyclodeaminase; OCD; EC 4.3.1.12 (characterized)
to candidate WP_086511985.1 BZY95_RS21785 ornithine cyclodeaminase
Query= SwissProt::Q59701 (356 letters) >NCBI__GCF_002151265.1:WP_086511985.1 Length = 313 Score = 112 bits (279), Expect = 2e-29 Identities = 83/264 (31%), Positives = 128/264 (48%), Gaps = 13/264 (4%) Query: 57 HSQDG--VIELMPTSDGSLY-GFKYVNGHPKNTHQGRQTVTAFGVLSDVGNGYPLLLSEM 113 H DG + LMP + + Y G K VN P+N G + LS+ +G PL E Sbjct: 41 HRPDGEATMLLMPAWERAGYIGVKMVNVFPQNAEHGLPAIAGVYFLSEGAHGRPLACLEG 100 Query: 114 TILTALRTAATSALAAKYLARPNSKTMAIIGNGAQSEFQARAFRAILGIQKLRLFDIDTS 173 + LT RTAA SALAA+ LAR +++++ ++G G + A A+ I+++R++ + Sbjct: 101 SELTRRRTAAASALAARELAREDAQSLLVVGTGKLAPMVIEAHAAVRPIRRVRVWGRNVE 160 Query: 174 ATRKCARNLTGPGFDIVECGSVAEAVEGADVITTVTADKQFATILSDNHVGPGVHINAVG 233 R+ A FD +A A ADVI+ VT + ++ + PG H++ +G Sbjct: 161 KARQVAAEY-AERFDCEAVEDLAAAARKADVISCVTLSSE--PLIRGEWLTPGTHLDLIG 217 Query: 234 GDCPGKTEISMEVLLRSDIFVE-YPPQTWIEGDIQQ------LPRTHPVTELWQVMTGEK 286 P E E L RS +FV+ Y GD+ Q +L +++ GEK Sbjct: 218 AFRPSMRETDAECLRRSQVFVDTYAGARGEAGDLHQAIAEGTFSFDDIAADLAELLKGEK 277 Query: 287 TGRVGDRQITMFDSVGFAIEDFSA 310 GR IT+F SVG ++ED +A Sbjct: 278 PGRTSPDAITLFKSVGASLEDLAA 301 Lambda K H 0.320 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 198 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 313 Length adjustment: 28 Effective length of query: 328 Effective length of database: 285 Effective search space: 93480 Effective search space used: 93480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory