Align [amino group carrier protein]-C-terminal-L-glutamyl-γ-L-lysine aminotransferase (EC 2.6.1.118; EC 2.6.1.124) (characterized)
to candidate WP_086510803.1 BZY95_RS15480 4-aminobutyrate--2-oxoglutarate transaminase
Query= metacyc::MONOMER-18314 (387 letters) >NCBI__GCF_002151265.1:WP_086510803.1 Length = 430 Score = 199 bits (507), Expect = 9e-56 Identities = 127/396 (32%), Positives = 197/396 (49%), Gaps = 31/396 (7%) Query: 16 KGEAQYVWDIEGRRYLDFHTGIGVAFLGHRNPIILEYLKNQLENIS-ILSTSFSTPIKDE 74 + E +WD +G R +DF GIGV +GHR+P ++E +K QL+ + T + Sbjct: 28 RAENALIWDADGNRIIDFAGGIGVLNIGHRHPKVVEAVKAQLDKVMHTCQTVMPYEGYVK 87 Query: 75 MLQALDKVKPDKMD-NAMLLNSGTEAVEAALKTARKITGRKKIIAFKNAFHGRT------ 127 + + L +V P + ML NSG EA+E A+K AR TG+ +I F +HGRT Sbjct: 88 VAEKLSQVTPVRGHAKVMLANSGAEALENAVKIARAATGKNNVICFDGGYHGRTFMTMAM 147 Query: 128 -------AGSLSVTWNKKYREPFE-PLVGPVEFLTFNNIEDLSKID---NETAAVIVEPI 176 A +R P+ P G E ++ K D +TAA+++EP+ Sbjct: 148 NGKVAPYASDFGTMPGNVFRAPYPVPYHGVSEDEAIRGLKMAIKTDANPRDTAAIVLEPV 207 Query: 177 QGESGVIPANIEFMKALKEKTENTGSLLIFDEIQTGFGRTGKLWAYKHYNIVPDILTAGK 236 GE G PA F+KA++E + G L+I DE+Q+GFGRTGKL+A +H + PDI+T K Sbjct: 208 LGEGGFYPAPASFLKAIREICDEHGMLMIVDEVQSGFGRTGKLFAIEHSGVEPDIITMAK 267 Query: 237 AIGGGFPVSVVFLPDHIANKLEEGDHGSTYGGNPMAMAAVTAACKVIEKENVVEQANQKG 296 ++ G P+S V D + + G TY GNP++ AA A V E+EN++E++ G Sbjct: 268 SMADGMPISAVVGTDKVMDASGPNSLGGTYTGNPLSCAATLAVLDVFEEENILEKSMALG 327 Query: 297 QQFSNILVKNLADLKVVREVRGKGLMIGIDI-----RFQP-----GQVLKYLQEKGILAV 346 + + + D V R G M +D+ + P + K +EKG++ + Sbjct: 328 DKLAKRFAQWQRDFDCVDNARNMGAMAALDLVTDKAKHTPDADLAAALCKKAREKGLILL 387 Query: 347 KAG--STVIRFLPSYLITYENMEEASNVLREGLLKI 380 G IRFL I E +EE +++ L ++ Sbjct: 388 SCGLYGNTIRFLMPVTIEDEILEEGLDIVEAALTEL 423 Lambda K H 0.317 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 430 Length adjustment: 31 Effective length of query: 356 Effective length of database: 399 Effective search space: 142044 Effective search space used: 142044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory