Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.17; EC 2.7.2.19 (uncharacterized)
to candidate WP_086509007.1 BZY95_RS05700 acetylglutamate kinase
Query= curated2:A8AA51 (264 letters) >NCBI__GCF_002151265.1:WP_086509007.1 Length = 306 Score = 127 bits (320), Expect = 2e-34 Identities = 87/257 (33%), Positives = 143/257 (55%), Gaps = 18/257 (7%) Query: 2 IVVKAGGRTLLNN--MDEIVKSISRLEKA----VFVHGGGDLVDEWERKMGMEPQFKVSA 55 +VVK GG + + +D +++ +++ V VHGGG + + K+ +E +F Sbjct: 30 VVVKYGGNAMTEDTLIDSFARNMVLMKEVGINPVVVHGGGPQIGDLLAKLKIESRF---V 86 Query: 56 SGIKFRYTDEKELEVFVAVLGGLLNKKIVASFASYGRGAVGLTGADGPSVIAERKKKVIV 115 +G+ R TD + ++V VLGGL+NK+IV G A+GLTG DG + A + K V Sbjct: 87 NGM--RVTDSETMDVVEMVLGGLVNKEIVNLINQCGGKAIGLTGKDGAQIRARQLK---V 141 Query: 116 QEKVGERLVKRAIAGGYTGKIKEVKTDLIKALVERGLVPVVAPIALSPEGELLNVNGDQM 175 + + E I G+ G+++ V TDLI+ L ER +PV+API + +G N+N D + Sbjct: 142 EHQTPEMTAPEIIDIGHVGEVEHVSTDLIEMLAERDFIPVIAPIGVDAKGNSYNINADLV 201 Query: 176 AAELAKALSAEYLVLLTDVPGVL-MDGKVVPEIKSSEAEEVAK--KVGPGMNIKIIMAGR 232 A ++A+AL AE L+LLT+V G++ +G+V+ + +++ + + + GM KI A Sbjct: 202 AGKVAEALGAEKLMLLTNVAGLMNAEGEVLTGLTTAQVDALIADGTIHGGMLPKIRCALD 261 Query: 233 VASGGTKVV-ICDGTVP 248 GG + I DG VP Sbjct: 262 AVKGGVRSAHIIDGRVP 278 Lambda K H 0.316 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 236 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 264 Length of database: 306 Length adjustment: 26 Effective length of query: 238 Effective length of database: 280 Effective search space: 66640 Effective search space used: 66640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory