Align aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_086511746.1 BZY95_RS20540 hypothetical protein
Query= BRENDA::Q5JK18 (570 letters) >NCBI__GCF_002151265.1:WP_086511746.1 Length = 450 Score = 145 bits (367), Expect = 3e-39 Identities = 105/327 (32%), Positives = 163/327 (49%), Gaps = 17/327 (5%) Query: 94 GGDQLSVVMKFGGSSVSSAARMREVAGLILAFPEERPVVVLSAMGKTTNLLLLAGEKAVG 153 G ++ V KFGG+S+ A +R + L+ + VVV+SAMGKTTN L A G Sbjct: 13 GEPDMTTVFKFGGASIKDADAIRHLTPLLERHRDRPLVVVVSAMGKTTNKLEALLAAARG 72 Query: 154 CGVIRVSEIEE-WNLIKDLHIKTVEELA-----LPRSVIHTMLDELEQLLKGIAMMKELT 207 G + E + ++ H + +E L PR + + DEL+ + Sbjct: 73 EGGTQGDEYRRCFEALQTEHREAIEALFGDAADSPRECVDALFDELDAQHRRHRDSDHA- 131 Query: 208 LRTTDYLVSFGECMSTRIFAAYLNKIGVKARQYDAFDIGFITTDDFGNADILE--ATYPA 265 + D V +GE +ST I AA+LN + +DA ++ + TD A L+ T Sbjct: 132 -KHYDQTVCYGELISTTIVAAWLNHNDIATDWHDAREL--VRTDACYQAANLDWSTTAET 188 Query: 266 VAKRLHGDWIRDPAIPIVTGFLGKGWKSGAVTTLGRGGSDLTATTIGKALGLREIQVWKD 325 V +RL G + + GF+G G G TTLGR GSD +A L RE+ +WKD Sbjct: 189 VRQRLAGS----DRVILTQGFIG-GTAEGEATTLGREGSDFSAAIFAHCLDAREVVIWKD 243 Query: 326 VDGVLTCDPNIYPNATTVPYLTFEEAAELAYFGAQVLHPQSMRPAREGDIPVRVKNSYNP 385 V G+ DP + NA + +++ EA E A+ GA+V+HP+++ P +E IP+ V++ P Sbjct: 244 VTGLFNADPRRFDNAVQLERISYAEATERAWHGAKVIHPKTLGPLQEKSIPLTVRSFETP 303 Query: 386 KAPGTLITKQREMDKVVLTSIVLKSNV 412 A T+I +R D V + I+ ++ V Sbjct: 304 DAEPTVIDAERRFDSDVASCILREAQV 330 Lambda K H 0.320 0.136 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 24 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 570 Length of database: 450 Length adjustment: 34 Effective length of query: 536 Effective length of database: 416 Effective search space: 222976 Effective search space used: 222976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
Align candidate WP_086511746.1 BZY95_RS20540 (hypothetical protein)
to HMM TIGR00657 (aspartate kinase (EC 2.7.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00657.hmm # target sequence database: /tmp/gapView.28475.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00657 [M=442] Accession: TIGR00657 Description: asp_kinases: aspartate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.3e-73 233.7 0.0 2.6e-73 233.5 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086511746.1 BZY95_RS20540 hypothetical prote Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086511746.1 BZY95_RS20540 hypothetical protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 233.5 0.0 2.6e-73 2.6e-73 2 330 .. 17 359 .. 16 394 .. 0.86 Alignments for each domain: == domain 1 score: 233.5 bits; conditional E-value: 2.6e-73 TIGR00657 2 aliVqKFGGtSvgnverikkvakivkkekekgnqvvVVvSAmagvTdaLvelaekvsseee......ke 64 ++ V KFGG S+++++ i+++ ++++++ +++ vVVvSAm+++T++L +l + e + lcl|NCBI__GCF_002151265.1:WP_086511746.1 17 MTTVFKFGGASIKDADAIRHLTPLLERHR--DRPLVVVVSAMGKTTNKLEALLAAARGEGGtqgdeyRR 83 678*********************99988..789******************99998877778888877 PP TIGR00657 65 liekirekhlealeela...sqalkeklkallekeleevkk......ereldlilsvGEklSaallaaa 124 e+++++h ea+e+l ++ +e + al ++ ++ ++ +++d +++GE +S++++aa+ lcl|NCBI__GCF_002151265.1:WP_086511746.1 84 CFEALQTEHREAIEALFgdaADSPRECVDALFDELDAQHRRhrdsdhAKHYDQTVCYGELISTTIVAAW 152 7888888888888887542234456666666666666655599999999******************** PP TIGR00657 125 leelgvkavsllgaeagiltdsefgrAkvleeikterleklleeg.iivvvaGFiGatekgeittLGRG 192 l++ + a ++ +a++ ++td+ ++ A+ ++++e + + l + +++GFiG t +ge ttLGR lcl|NCBI__GCF_002151265.1:WP_086511746.1 153 LNHND-IATDWHDARELVRTDACYQAANLDWSTTAETVRQRLAGSdRVILTQGFIGGTAEGEATTLGRE 220 *****.99********************777888888888877767*********************** PP TIGR00657 193 GSDltAallAaalkAdeveiytDVdGiytaDPrivpeArrldeisyeEalELaslGakvLhprtlepam 261 GSD++Aa+ A++l+A+ev i++DV G + aDPr +A +l+ isy+Ea E a +Gakv+hp+tl p+ lcl|NCBI__GCF_002151265.1:WP_086511746.1 221 GSDFSAAIFAHCLDAREVVIWKDVTGLFNADPRRFDNAVQLERISYAEATERAWHGAKVIHPKTLGPLQ 289 ********************************************************************* PP TIGR00657 262 rakipivvkstfnpeaeGTlivakskseeepavkalsldknqalvsvsgttmk...pgilaevfgalae 327 +++ip+ v+s p+ae T+i a++ ++ v + l++ q+ v+v+ +++g+l + lcl|NCBI__GCF_002151265.1:WP_086511746.1 290 EKSIPLTVRSFETPDAEPTVIDAERRF--DSDVASCILREAQVWVEVRPRDFSfmdEPRQHDILGRLVK 356 ************************773..3578888888888888887665554445555566666655 PP TIGR00657 328 akv 330 a+ lcl|NCBI__GCF_002151265.1:WP_086511746.1 357 AGL 359 555 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (442 nodes) Target sequences: 1 (450 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 8.49 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory