Align homoserine dehydrogenase (EC 1.1.1.3); aspartate kinase (EC 2.7.2.4) (characterized)
to candidate WP_086509286.1 BZY95_RS07285 aspartate kinase
Query= BRENDA::Q9WZ17 (739 letters) >NCBI__GCF_002151265.1:WP_086509286.1 Length = 416 Score = 311 bits (797), Expect = 4e-89 Identities = 173/413 (41%), Positives = 261/413 (63%), Gaps = 17/413 (4%) Query: 339 SVVVMKFGGAAISDVEKLEKVAEKIIKRKKSGVKPVVVLSAMGDTTDHLIELAKTIDENP 398 ++ V KFGG ++ VE+++ VAEK+ + G + VVV+SAM T+ LI +A I++ P Sbjct: 2 ALYVQKFGGTSVGSVERIKAVAEKVKGFRDDGHQVVVVVSAMSGETNRLIAMANEINDEP 61 Query: 399 DPRELDLLLSTGEIQSVALMSIALRKRGYKAISFTGNQLKIITDKRYGSARIIDINTDII 458 PRE+D+L+STGE +++L+++AL K G A S+TG+Q+ I+TD + ARI I TD + Sbjct: 62 TPREMDMLVSTGEQVTISLLALALHKLGVPATSYTGSQVGILTDSAHTKARIQRIETDEM 121 Query: 459 SRYLKQDFIPVVAGFQGITETGDITTLGRGGSDLTAIALAYSLGADLCELYKDVDGVYTA 518 L + + VVAGFQG+ E G+ITTLGRGGSD T +ALA +LGAD C++Y DVDGVYT Sbjct: 122 REDLDEGKVVVVAGFQGVDEEGNITTLGRGGSDTTGVALAAALGADECQIYTDVDGVYTT 181 Query: 519 DPRIVKDARVIKELSWEEMIELSRHGAQVLQARAAEFARKYGVKVLIKNAHKETRGTLI- 577 DPR+ A+ + ++ EEM+EL+ G++VLQ R+ EFA KY V + + ++ ++ GTLI Sbjct: 182 DPRVCSKAQRLDTITVEEMLELASLGSKVLQIRSVEFAGKYNVPLRVLSSFQDGPGTLIV 241 Query: 578 ----WEGTKVENPIVRAVTFEDGMAKVVLKDVPDKPGVAARIMRTLSQMGVNIDMIIQGM 633 + +E P++ + F AK+ L PD PGVA+RI+ ++ + +DMI+Q + Sbjct: 242 AESDQDEDSMEEPLISGIAFTANEAKLTLLHTPDVPGVASRILGPIADANIEVDMIVQNV 301 Query: 634 -KSGEYNTVAFIVPESQLGKLDIDLLKTRSE-------AKEIIIEKGLAKVSIVGVNLTS 685 +G+Y F V + K LK E E+ + +AKVS+VGV + S Sbjct: 302 APAGDYTDFTFTVAKGDYKK----TLKILEEQVIPDLGGGEVNGDDNIAKVSLVGVGMRS 357 Query: 686 TPEISATLFETLANEGINIDMISASSSRISVIIDGKYVEDAVKAIHSRFELDR 738 ++A +F LA+E INI M+S S +ISV+ID K +E AV+A+H+ F LD+ Sbjct: 358 HAGVAAKMFRVLADENINIRMVSTSEIKISVVIDEKQMELAVRALHTAFGLDK 410 Lambda K H 0.318 0.137 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 695 Number of extensions: 34 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 739 Length of database: 416 Length adjustment: 36 Effective length of query: 703 Effective length of database: 380 Effective search space: 267140 Effective search space used: 267140 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory