Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate WP_086508660.1 BZY95_RS03820 homoserine kinase
Query= SwissProt::P29364 (316 letters) >NCBI__GCF_002151265.1:WP_086508660.1 Length = 320 Score = 269 bits (688), Expect = 6e-77 Identities = 139/308 (45%), Positives = 185/308 (60%), Gaps = 1/308 (0%) Query: 1 MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQD 60 M+VFTPL + + FL +D+G L G+A G+ENS FFV+ + E VLTL E+G ++ Sbjct: 1 MAVFTPLSDAQVAEFLRRFDVGELVSLAGVAGGTENSTFFVTTDRHELVLTLFEQGEHEE 60 Query: 61 LPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEV 120 LPFF+ELLD L E LPVP + R+G AL L GKP+LL PRL GRH PN C+ + Sbjct: 61 LPFFVELLDYLDEHRLPVPGPVHDREGIALHSLAGKPSLLFPRLPGRHPMSPNLTQCRAL 120 Query: 121 GDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALAEIAALDAER 180 GD LG +H ++ RP+ R L W+ + L + + L+ + + + Sbjct: 121 GDALGRMHVVSQHFPGHRPNPRDLNWLTAMHHKVLGYLSPEDQTLMKDEVEIYQGVFGDA 180 Query: 181 PALPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSNTDGSLDPA 240 P LP LH DLFRDN LF+ L G+IDFYN C+G +L+DLAI +NDW S DG LD A Sbjct: 181 PELPHGALHGDLFRDNTLFEDDRLGGIIDFYNGCTGDLLFDLAIVINDWASGPDGRLDRA 240 Query: 241 RARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAAEAF-AGQDVLIHDPAEFE 299 R A+++AY RRP TA E E WP+MLR+ +R+WLSRL+ D+ HDPA+F Sbjct: 241 RHDAIISAYQARRPLTATEREVWPTMLRMTALRYWLSRLLVVYVDPPAHDLTPHDPAQFH 300 Query: 300 IRLAQRQN 307 L R N Sbjct: 301 TILTARLN 308 Lambda K H 0.324 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 320 Length adjustment: 27 Effective length of query: 289 Effective length of database: 293 Effective search space: 84677 Effective search space used: 84677 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
Align candidate WP_086508660.1 BZY95_RS03820 (homoserine kinase)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00938.hmm # target sequence database: /tmp/gapView.27130.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00938 [M=307] Accession: TIGR00938 Description: thrB_alt: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-92 294.5 0.0 5.5e-92 294.3 0.0 1.0 1 lcl|NCBI__GCF_002151265.1:WP_086508660.1 BZY95_RS03820 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_002151265.1:WP_086508660.1 BZY95_RS03820 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 294.3 0.0 5.5e-92 5.5e-92 1 306 [. 1 304 [. 1 305 [. 0.96 Alignments for each domain: == domain 1 score: 294.3 bits; conditional E-value: 5.5e-92 TIGR00938 1 mavytsvsdeeleafLegydlGellslkGiaeGvensnyllttdkgryvLtlyekrvkaeeLPfflell 69 mav+t +sd ++ +fL +d+Gel+sl G+a G ens +++ttd+ vLtl+e+ +eeLPff+ell lcl|NCBI__GCF_002151265.1:WP_086508660.1 1 MAVFTPLSDAQVAEFLRRFDVGELVSLAGVAGGTENSTFFVTTDRHELVLTLFEQGE-HEELPFFVELL 68 9******************************************************99.9********** PP TIGR00938 70 thLaerglpvakpvksrdGralseLaGkPaalvefLkGssvakPtaercrevgevlaklhlagadfkee 138 ++L e+ lpv+ pv+ r+G al +LaGkP+ l L+G+ P +++cr+ g+ l ++h+ +++f+++ lcl|NCBI__GCF_002151265.1:WP_086508660.1 69 DYLDEHRLPVPGPVHDREGIALHSLAGKPSLLFPRLPGRHPMSPNLTQCRALGDALGRMHVVSQHFPGH 137 ********************************************************************* PP TIGR00938 139 rkndlrleaWsilaakkfkvleqleeelaalldkeldalkkflpr..dLPrgvihadlfkdnvlldgdk 205 r n +r +W +++ k vl l++e+++l+++e++ + +++ +LP+g +h dlf+dn l++ d+ lcl|NCBI__GCF_002151265.1:WP_086508660.1 138 RPN-PRDLNWLTAMHHK--VLGYLSPEDQTLMKDEVEIYQGVFGDapELPHGALHGDLFRDNTLFEDDR 203 ***.999***9988777..******************99998754338********************* PP TIGR00938 206 lkgvidfyfaCedallydlaiavndWcfeaddkldaaaakallkgyeavrpLseeekaafpvllrgaal 274 l+g+idfy C++ ll+dlai +ndW+ d++ld a+ a++ +y+a+rpL++ e++ +p++lr +al lcl|NCBI__GCF_002151265.1:WP_086508660.1 204 LGGIIDFYNGCTGDLLFDLAIVINDWASGPDGRLDRARHDAIISAYQARRPLTATEREVWPTMLRMTAL 272 ********************************************************************* PP TIGR00938 275 rfllsrlldlvftqagelvvakdPaeferkLk 306 r++lsrll + ++ ++ dPa+f+ +L lcl|NCBI__GCF_002151265.1:WP_086508660.1 273 RYWLSRLLVVYVDPPAHDLTPHDPAQFHTILT 304 ******9876655555555699*****99885 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (320 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.12 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory