Align phosphoribosylanthranilate isomerase (EC 5.3.1.24) (characterized)
to candidate WP_086508672.1 BZY95_RS03885 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
Query= BRENDA::P16250 (240 letters) >NCBI__GCF_002151265.1:WP_086508672.1 Length = 250 Score = 141 bits (355), Expect = 1e-38 Identities = 83/233 (35%), Positives = 126/233 (54%), Gaps = 4/233 (1%) Query: 6 LLPAVDVRDGQAVRLVHGESGTETSYGS-PLEAALAWQRSGAEWLHLVDLDAAF-GTGDN 63 ++PA+D++DG+ VRL G T+YG P+ A W +GA LHLVDL+ AF G N Sbjct: 3 VIPAIDLKDGKCVRLKQGRMDDATTYGDDPVAMAARWVEAGARRLHLVDLNGAFEGKPIN 62 Query: 64 RALIAEVAQAM-DIKVELSGGIRDDDTLAAALATGCTRVNLGTAALETPEWVAKVIAEHG 122 + +A+ ++ +++ GGIR +T+ LA G + V +GT A++ P +V +V Sbjct: 63 GEAVTAIARRWPELPIQIGGGIRSAETIEHYLAAGVSYVIIGTKAVKEPAFVGEVCRAFP 122 Query: 123 DKIAVGLDVRGTTLRGRGWTRDGG-DLYETLDRLNKEGCARYVVTDIAKDGTLQGPNLEL 181 + VGLD R + GW + R +G + V TDIA+DG + G N+E Sbjct: 123 GHVIVGLDARDGFVATDGWAEVSQVKAVDLAKRFADDGVSSIVYTDIARDGMMNGVNVEA 182 Query: 182 LKNVCAATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKALYAKAFTLEE 234 + PV+ASGGV++LDDLRA+ G+ GAI G+A+Y + E Sbjct: 183 TAELAREGGLPVIASGGVTNLDDLRALVAAGEPGILGAITGRAIYEGTLDVAE 235 Lambda K H 0.315 0.133 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 250 Length adjustment: 24 Effective length of query: 216 Effective length of database: 226 Effective search space: 48816 Effective search space used: 48816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory