Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate WP_090446092.1 BLS63_RS15070 shikimate dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >NCBI__GCF_900100495.1:WP_090446092.1 Length = 274 Score = 414 bits (1064), Expect = e-120 Identities = 207/274 (75%), Positives = 230/274 (83%) Query: 1 MDQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVT 60 MD+Y VFGNPI HSKSPLIHRLFA QTGQ L Y LLAPL++F AR FF G GGNVT Sbjct: 1 MDRYGVFGNPIAHSKSPLIHRLFAAQTGQQLSYEALLAPLEDFPGFARAFFVDGKGGNVT 60 Query: 61 VPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGK 120 VPFKE+AF+L DSLT RARRAGAVNTL KL DG L GDNTDGAGLVRDLT+NAG L G+ Sbjct: 61 VPFKEQAFQLADSLTARARRAGAVNTLKKLDDGRLLGDNTDGAGLVRDLTLNAGFALRGQ 120 Query: 121 RILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQEP 180 RIL+LGAGGAVRGVLEP+LA +P SLVIANRT+ KAEQLA EF +LGPV+ASGF W+ P Sbjct: 121 RILLLGAGGAVRGVLEPLLAQQPASLVIANRTLAKAEQLASEFADLGPVLASGFDWIDAP 180 Query: 181 VDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAKVLDGLG 240 VD+I+N TSASLAGELPPIA SL+ G T+CYDMMYGKEPT F +WA GAA+ LDGLG Sbjct: 181 VDLIVNGTSASLAGELPPIAASLIAPGHTLCYDMMYGKEPTAFNRWAAAHGAARTLDGLG 240 Query: 241 MLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG 274 ML EQAAEAFF+WRGVRPD+APVLAELRRQL +G Sbjct: 241 MLVEQAAEAFFLWRGVRPDSAPVLAELRRQLQQG 274 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 274 Length adjustment: 25 Effective length of query: 249 Effective length of database: 249 Effective search space: 62001 Effective search space used: 62001 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_090446092.1 BLS63_RS15070 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.27401.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.4e-81 259.6 0.0 1.5e-81 259.5 0.0 1.0 1 lcl|NCBI__GCF_900100495.1:WP_090446092.1 BLS63_RS15070 shikimate dehydrog Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900100495.1:WP_090446092.1 BLS63_RS15070 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 259.5 0.0 1.5e-81 1.5e-81 3 269 .. 4 271 .. 2 272 .. 0.94 Alignments for each domain: == domain 1 score: 259.5 bits; conditional E-value: 1.5e-81 TIGR00507 3 lgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlell 71 +gv+Gnpi+hSksplih +++q+g++l Y a+ +++e+++ + +++ g kG nvTvPfKe++++l+ lcl|NCBI__GCF_900100495.1:WP_090446092.1 4 YGVFGNPIAHSKSPLIHRLFAAQTGQQLSYEALLAPLEDFPGFARAFFVDG-KGGNVTVPFKEQAFQLA 71 9***********************************************998.788************** PP TIGR00507 72 DeieesakligavNTlk.ledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlk 138 D ++ +a+ +gavNTlk l+dg+l+g+nTDg Glv +L + ++r+l++GAGGa ++v+ +Ll lcl|NCBI__GCF_900100495.1:WP_090446092.1 72 DSLTARARRAGAVNTLKkLDDGRLLGDNTDGAGLVRDLTLnAGFALRGQRILLLGAGGAVRGVLEPLLA 140 *****************9********************987676666*******************987 PP TIGR00507 139 a.dkeviiaNRtvekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkaellke 206 + + +++iaNRt++kae+la++++ lg +la + ++ vdli+n tsa+l ge+ +++ a+l++ lcl|NCBI__GCF_900100495.1:WP_090446092.1 141 QqPASLVIANRTLAKAEQLASEFADLGPVLASGFDWID-APVDLIVNGTSASLAGEL--PPIAASLIAP 206 65899************************998877776.57****************..9999999987 PP TIGR00507 207 g.klvvDlvynpletpllkeakkkg.tkvidGlgMlvaQaalsFelwtgvepdvekvfealkekl 269 g +l++D++y + t++ ++a +g ++++dGlgMlv+Qaa +F lw+gv pd v l+++l lcl|NCBI__GCF_900100495.1:WP_090446092.1 207 GhTLCYDMMYGKEPTAFNRWAAAHGaARTLDGLGMLVEQAAEAFFLWRGVRPDSAPVLAELRRQL 271 62689********************99***************************99999988877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (274 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.85 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory