Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (characterized)
to candidate WP_090445975.1 BLS63_RS14830 homoserine kinase
Query= SwissProt::P29364 (316 letters) >NCBI__GCF_900100495.1:WP_090445975.1 Length = 316 Score = 468 bits (1204), Expect = e-137 Identities = 240/316 (75%), Positives = 255/316 (80%) Query: 1 MSVFTPLERSTLEAFLAPYDLGRLRDFRGIAEGSENSNFFVSLEHGEFVLTLVERGPVQD 60 MSVFTPLER LEAFLAPY LGRLRDF+GIA GSENSNFFVSLE GEFVLTL+ERGP D Sbjct: 1 MSVFTPLERHELEAFLAPYGLGRLRDFQGIAAGSENSNFFVSLEQGEFVLTLIERGPSDD 60 Query: 61 LPFFIELLDVLHEDGLPVPYALRTRDGEALRRLEGKPALLQPRLAGRHERQPNAHHCQEV 120 LPFFIELLDVLH GLPVPYALRT GEALR L KPALLQPRL G+H PN HHC EV Sbjct: 61 LPFFIELLDVLHAAGLPVPYALRTESGEALRSLAEKPALLQPRLPGKHVAWPNPHHCAEV 120 Query: 121 GDLLGHLHAATRGRILERPSDRGLPWMLEQGANLAPRLPEQARALLAPALAEIAALDAER 180 G LL LH ATR R LER SDRGL WMLE+G +LA +L + LL ALAEI AL Sbjct: 121 GGLLARLHLATRERPLERKSDRGLDWMLEEGPSLALKLADAQLPLLRAALAEIHALKPRI 180 Query: 181 PALPRANLHADLFRDNVLFDGPHLAGLIDFYNACSGWMLYDLAITLNDWCSNTDGSLDPA 240 ALPRANLHADLFRDNVLFDG HLAG+IDFYNACSG MLYDLAI LNDWCS DG LDP Sbjct: 181 LALPRANLHADLFRDNVLFDGNHLAGVIDFYNACSGPMLYDLAIALNDWCSEADGRLDPH 240 Query: 241 RARALLAAYANRRPFTALEAEHWPSMLRVACVRFWLSRLIAAEAFAGQDVLIHDPAEFEI 300 RA+ALL AYA RPF+A EAE WP+MLR+ACVRFWLSRLIAA++FAGQ VLIHDPAEF Sbjct: 241 RAQALLGAYAALRPFSAAEAELWPAMLRIACVRFWLSRLIAADSFAGQQVLIHDPAEFRR 300 Query: 301 RLAQRQNVEIHLPFAL 316 RL QRQ VE+ LPFAL Sbjct: 301 RLEQRQQVEVALPFAL 316 Lambda K H 0.324 0.140 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 316 Length of database: 316 Length adjustment: 27 Effective length of query: 289 Effective length of database: 289 Effective search space: 83521 Effective search space used: 83521 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 48 (23.1 bits)
Align candidate WP_090445975.1 BLS63_RS14830 (homoserine kinase)
to HMM TIGR00938 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00938.hmm # target sequence database: /tmp/gapView.25408.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00938 [M=307] Accession: TIGR00938 Description: thrB_alt: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-91 290.4 0.0 9.5e-91 290.3 0.0 1.0 1 lcl|NCBI__GCF_900100495.1:WP_090445975.1 BLS63_RS14830 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900100495.1:WP_090445975.1 BLS63_RS14830 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 290.3 0.0 9.5e-91 9.5e-91 1 306 [. 1 303 [. 1 304 [. 0.97 Alignments for each domain: == domain 1 score: 290.3 bits; conditional E-value: 9.5e-91 TIGR00938 1 mavytsvsdeeleafLegydlGellslkGiaeGvensnyllttdkgryvLtlyekrvkaeeLPfflell 69 m+v+t + +eleafL y lG+l +++Gia G ensn+++ ++g +vLtl e+ +++LPff+ell lcl|NCBI__GCF_900100495.1:WP_090445975.1 1 MSVFTPLERHELEAFLAPYGLGRLRDFQGIAAGSENSNFFVSLEQGEFVLTLIERGP-SDDLPFFIELL 68 9*****************************************************999.9********** PP TIGR00938 70 thLaerglpvakpvksrdGralseLaGkPaalvefLkGssvakPtaercrevgevlaklhlagadfkee 138 + L + glpv+ ++++++G+al +La kPa l L+G+ va P +++c+evg la+lhla+ + + e lcl|NCBI__GCF_900100495.1:WP_090445975.1 69 DVLHAAGLPVPYALRTESGEALRSLAEKPALLQPRLPGKHVAWPNPHHCAEVGGLLARLHLATRERPLE 137 ********************************************************************* PP TIGR00938 139 rkndlrleaWsilaakkfkvleqleeelaalldkeldalkkflpr..dLPrgvihadlfkdnvlldgdk 205 rk r +W + ++ +l + + ll++ l+ ++ + pr LPr+ +hadlf+dnvl+dg++ lcl|NCBI__GCF_900100495.1:WP_090445975.1 138 RKS-DRGLDWMLEEGPS--LALKLADAQLPLLRAALAEIHALKPRilALPRANLHADLFRDNVLFDGNH 203 **9.67889*9998888..9999999999***************95568******************** PP TIGR00938 206 lkgvidfyfaCedallydlaiavndWcfeaddkldaaaakallkgyeavrpLseeekaafpvllrgaal 274 l+gvidfy aC++ +lydlaia+ndWc ead++ld ++a+all++y a rp+s+ e + +p +lr a++ lcl|NCBI__GCF_900100495.1:WP_090445975.1 204 LAGVIDFYNACSGPMLYDLAIALNDWCSEADGRLDPHRAQALLGAYAALRPFSAAEAELWPAMLRIACV 272 ********************************************************************* PP TIGR00938 275 rfllsrlldlvftqagelvvakdPaeferkLk 306 rf+lsrl + ag+ v + dPaef+r+L+ lcl|NCBI__GCF_900100495.1:WP_090445975.1 273 RFWLSRLIAA-DSFAGQQVLIHDPAEFRRRLE 303 *******975.567999*************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (307 nodes) Target sequences: 1 (316 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.11 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory