Align Phosphoserine phosphatase; PSP; PSPase; O-phosphoserine phosphohydrolase; EC 3.1.3.3 (characterized)
to candidate WP_092991383.1 BLP65_RS00080 phosphoserine phosphatase SerB
Query= SwissProt::Q9S281 (410 letters) >NCBI__GCF_900102855.1:WP_092991383.1 Length = 407 Score = 272 bits (696), Expect = 1e-77 Identities = 168/396 (42%), Positives = 232/396 (58%), Gaps = 22/396 (5%) Query: 12 LLVKIFGKDRPGITAGLFDTLAAYSVDVVDIEQVVTRGRIVLCALVTEPPRGLEG----- 66 +LV + G DRPGITA L LA Y+V ++D+ Q V + L L+ E PR G Sbjct: 5 VLVTVVGPDRPGITAALTGCLANYNVTILDVGQSVIHDTVSLGMLI-ELPRDAGGCLVFK 63 Query: 67 DLRATVHSWAESLKLQAEIISGIGDNR---PRGFGRSLVTVLGHPLTAEATAAIAARITE 123 DL H L ++ +S + +G R +VT+LG +++ A +A + Sbjct: 64 DLLLKAHEL--DLNVRFTPVSEEDYEQWVAAQGQSRHIVTLLGRQISSRHLARVAEVVAH 121 Query: 124 SGSNIDRIFRLA---------KYPVTAVEFAVSG--VETEPLRTALATEAAALGVDIAVV 172 G NID I RL + + +VE ++ G + L A AL +DIA+ Sbjct: 122 HGLNIDNITRLTGRISLRRPEEKRIASVELSIRGDVPDLTMLHAHFLETARALEIDIAIQ 181 Query: 173 AAGLHRRAQRLVVMDVDSTLIQDEVIELFAAHAGCEDEVAEVTAAAMRGELDFEQSLHAR 232 ++RR +RLV D+DSTLIQ EVI+ A AG E+EVA +T +AM GELDF S R Sbjct: 182 EDNIYRRNRRLVCFDMDSTLIQAEVIDELAREAGVEEEVAAITRSAMAGELDFADSFRKR 241 Query: 233 VALLAGLDASVVDKVRAEVRLTPGARTLIRTLKRLGYQVGVVSGGFTQVTDALQEQLGLD 292 +ALL GLD SV+ + + +T GA LIR LKR GY+V ++SGGFT + L+ +LG+D Sbjct: 242 MALLEGLDESVLRDIAERLPITEGAERLIRNLKRFGYKVAILSGGFTFFAEHLRRKLGID 301 Query: 293 FAQANTLEIVDGRLTGRVTGEIVDRAGKARLLRRFAAAAGVPLSQTVAIGDGANDLDMLN 352 + AN L+I G+LTG+V GEI+D KA LL + AA G+ L Q +A+GDGANDL ML+ Sbjct: 302 YVFANPLDIRQGKLTGKVKGEIIDGRRKAYLLHQLAAQEGISLEQVIAVGDGANDLPMLS 361 Query: 353 AAGLGVAFNAKPVVREAAHTAVNVPFLDTVLYLLGI 388 AGLG+AF+AKPVV+E A A+ LD +LYLLG+ Sbjct: 362 IAGLGIAFHAKPVVKEQAQHAITTLGLDAILYLLGM 397 Lambda K H 0.319 0.135 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 410 Length of database: 407 Length adjustment: 31 Effective length of query: 379 Effective length of database: 376 Effective search space: 142504 Effective search space used: 142504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate WP_092991383.1 BLP65_RS00080 (phosphoserine phosphatase SerB)
to HMM TIGR00338 (serB: phosphoserine phosphatase SerB (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00338.hmm # target sequence database: /tmp/gapView.7348.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00338 [M=219] Accession: TIGR00338 Description: serB: phosphoserine phosphatase SerB Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-89 283.5 0.1 7.3e-89 283.1 0.1 1.1 1 lcl|NCBI__GCF_900102855.1:WP_092991383.1 BLP65_RS00080 phosphoserine phos Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900102855.1:WP_092991383.1 BLP65_RS00080 phosphoserine phosphatase SerB # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 283.1 0.1 7.3e-89 7.3e-89 1 219 [] 177 395 .. 177 395 .. 0.99 Alignments for each domain: == domain 1 score: 283.1 bits; conditional E-value: 7.3e-89 TIGR00338 1 diakselskllkkkklvvfDlDstlieeEvIdeiaklaGveeeVseiTerAmrgeldFkeslreRvkll 69 dia +e++ ++++++lv+fD+Dstli++EvIde+a++aGveeeV++iT++Am geldF +s+r+R++ll lcl|NCBI__GCF_900102855.1:WP_092991383.1 177 DIAIQEDNIYRRNRRLVCFDMDSTLIQAEVIDELAREAGVEEEVAAITRSAMAGELDFADSFRKRMALL 245 689999*************************************************************** PP TIGR00338 70 kglpvellkkveeklelteGveelvkkLkekgykvaviSGgFdlvaeklkekLgldavfaNrLevedgk 138 gl++++l+ ++e+l++teG+e l+++Lk+ gykva++SGgF+++ae+l+ kLg+d+vfaN L++++gk lcl|NCBI__GCF_900102855.1:WP_092991383.1 246 EGLDESVLRDIAERLPITEGAERLIRNLKRFGYKVAILSGGFTFFAEHLRRKLGIDYVFANPLDIRQGK 314 ********************************************************************* PP TIGR00338 139 ltGkvegeivdesakaktllkllekegislektvavGDGanDlsmikaAglgiafnakpvlkekadivi 207 ltGkv+gei+d + ka l +l+ +egisle+++avGDGanDl+m++ Aglgiaf+akpv+ke+a+++i lcl|NCBI__GCF_900102855.1:WP_092991383.1 315 LTGKVKGEIIDGRRKAYLLHQLAAQEGISLEQVIAVGDGANDLPMLSIAGLGIAFHAKPVVKEQAQHAI 383 ********************************************************************* PP TIGR00338 208 ekkdltdilell 219 + l +il+ll lcl|NCBI__GCF_900102855.1:WP_092991383.1 384 TTLGLDAILYLL 395 *******99986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (219 nodes) Target sequences: 1 (407 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 9.05 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory