Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_092350824.1 BLU87_RS16360 shikimate dehydrogenase
Query= BRENDA::Q6PUG0 (521 letters) >NCBI__GCF_900107645.1:WP_092350824.1 Length = 283 Score = 128 bits (321), Expect = 3e-34 Identities = 95/298 (31%), Positives = 148/298 (49%), Gaps = 40/298 (13%) Query: 240 TKVFGLISKPVGHSKGPILHNPTFRHVGYNGIYVPMFV--DDLKEFFRVYSSPDFAGFSV 297 ++V+GL+ PV HS P++ N F+ + +Y P V DDL + D AG +V Sbjct: 7 SRVYGLLGDPVAHSLSPLMQNHAFQFHAIDAVYTPFHVAPDDLPAAVAGLRALDIAGVNV 66 Query: 298 GIPYKEAVVSFCDEVDPLAKSIGAVNTIIQRPCDGKLIGYNTDCEASITAIEDALKVNGL 357 IP+KEA++ D +DP A+ IGAVNT++ + +G L GYNTD I A++ L Sbjct: 67 TIPHKEAILPLLDRIDPAAQLIGAVNTVVNK--NGILSGYNTDASGFIKAVQQEL----- 119 Query: 358 TNGAAFLPSPLAGKLFVLVGAGGAGRA--------------LAFGAKSRRAEIV-IFDID 402 F P+ G+ V++GAGGA RA +A KSR E+V + Sbjct: 120 ----TFCPT---GRNVVVLGAGGACRACVVALVSAGVKSITVANRHKSRAVELVNDLQLH 172 Query: 403 FDRAKALAAAVSGEALPFENLASFQPEKGAILANATPIGMH-PNKDRIPVSEASLKDYVV 461 F AA PF + + ++ N T +G+H + + +P+ ++K + Sbjct: 173 FPTVDFYAADYLD---PFYRQSLSLAD---LIVNTTSVGLHGESVNFLPLE--NIKCSAL 224 Query: 462 VFDAVYTPRKTTLLKDAEAAGAITVSGVEMFLRQAIGQFHLFTRTKAPEEFMRDIVMA 519 +FD VY+P +T LLK+A AG + G+ M Q F L+T + P FMR +++ Sbjct: 225 IFDMVYSPSETPLLKNARLAGHLCADGLGMLAAQGEDAFFLWTGIRPPSGFMRKTLVS 282 Lambda K H 0.320 0.138 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 330 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 521 Length of database: 283 Length adjustment: 30 Effective length of query: 491 Effective length of database: 253 Effective search space: 124223 Effective search space used: 124223 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory