Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_092346870.1 BLU87_RS08685 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_900107645.1:WP_092346870.1 Length = 390 Score = 157 bits (398), Expect = 4e-43 Identities = 107/361 (29%), Positives = 179/361 (49%), Gaps = 7/361 (1%) Query: 32 DLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEP 91 D+VNL G+P P + AA A++ YS GI ELR A+A Y ++ + P Sbjct: 32 DVVNLCNGEPDFSTPSHICEAAIASIQGGDTRYSPTSGILELRQAVADKYTQQLKRRITP 91 Query: 92 DAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQ 151 D V+I G + +++ LA + GD V + P YP Y + + + V IP + FQ Sbjct: 92 DNVMIVCGGTEALMMSLLATVNPGDEVIVTDPCYPNYFAQIELVKAKCVSIPVYEKNNFQ 151 Query: 152 PTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVY 210 + L + I +G+++ P NP G E + ++ D +++ + SDEVY L Y Sbjct: 152 IDPEDLKKAISSRTKGIILNYPNNPLGVTASEEYIQSLEQLIDDNNLIVFSDEVYESLTY 211 Query: 211 QGAPQTSCAWQTSR---NAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICP 267 + S A Q R N +V+NS SK YAMTGWR+G+++ + +++ L + C Sbjct: 212 GKSGHYSLA-QNDRIKDNVLVMNSLSKTYAMTGWRIGYIVGHPKIMKSMFRLQESVLSCL 270 Query: 268 PVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVS 327 PV Q AA++A + + ++Y +LL+DG++ + + G V A++S Sbjct: 271 PVFIQKAALAALR-GSQDKVQEMASAYEKRMNLLVDGIQSMPGFKCIRPMGGLCVMANIS 329 Query: 328 DFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGPSGDIEEALRRIGSWLPS 387 + S F +LL + GV PG F G ++R FA +I++ + R+ S++ S Sbjct: 330 AYNKSSEEFSRELLENAGVMTVPGSAFG-PMGEGYIRFCFANSFENIQKGVERLSSYIAS 388 Query: 388 Q 388 + Sbjct: 389 R 389 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 390 Length adjustment: 30 Effective length of query: 358 Effective length of database: 360 Effective search space: 128880 Effective search space used: 128880 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory