Align Branched-chain-amino-acid aminotransferase 2; BCAT 2; Vegetative protein 85; VEG85; EC 2.6.1.42 (characterized)
to candidate WP_092053855.1 BQ4888_RS03735 branched-chain amino acid aminotransferase
Query= SwissProt::P39576 (363 letters) >NCBI__GCF_900111775.1:WP_092053855.1 Length = 354 Score = 397 bits (1019), Expect = e-115 Identities = 185/343 (53%), Positives = 251/343 (73%) Query: 10 LTSTKKPKPDPNQLSFGRVFTDHMFVMDYAADKGWYDPRIIPYQPLSMDPAAMVYHYGQT 69 LT+ K D ++L FG +FTD MF+MDY A +GW+ PRI+PY PLS+DP+ V HY Q Sbjct: 8 LTAKKSLFEDESKLGFGNLFTDRMFLMDYDAGEGWHSPRIVPYGPLSLDPSCAVLHYAQE 67 Query: 70 VFEGLKAYVSEDDHVLLFRPEKNMERLNQSNDRLCIPQIDEEQVLEGLKQLVAIDKDWIP 129 +FEGLKA+ D ++ LFRP N ER N+S R+C+P++D + VL+ LK L+ ++ DW+P Sbjct: 68 IFEGLKAFRRPDGNIALFRPRDNFERFNRSAARMCMPELDVDFVLKALKTLIHLESDWVP 127 Query: 130 NAEGTSLYIRPFIIATEPFLGVAASHTYKLLIILSPVGSYYKEGIKPVKIAVESEFVRAV 189 + GTSLYIRP +IAT+P+LGV S Y IILSPVG+YYK G PVKI + +VR+ Sbjct: 128 KSLGTSLYIRPTMIATDPYLGVHPSSKYLFYIILSPVGAYYKNGFSPVKIYISDGYVRSA 187 Query: 190 KGGTGNAKTAGNYASSLKAQQVAEEKGFSQVLWLDGIEKKYIEEVGSMNIFFKINGEIVT 249 GGTG AKT GNYA+SLKA A GF QVLWLD +E+KY+EEVGSMNI F +G++VT Sbjct: 188 PGGTGEAKTGGNYAASLKASMEAAALGFDQVLWLDAVERKYVEEVGSMNICFLYDGKVVT 247 Query: 250 PMLNGSILEGITRNSVIALLKHWGLQVSERKIAIDEVIQAHKDGILEEAFGTGTAAVISP 309 L G+IL+GITR S++AL+K GLQV ER +++DE+++ +G L+EAFGTGTAAV+SP Sbjct: 248 SPLKGTILDGITRRSILALVKELGLQVEERALSVDEILEGAGNGRLKEAFGTGTAAVVSP 307 Query: 310 VGELIWQDETLSINNGETGEIAKKLYDTITGIQKGAVADEFGW 352 VG+ ++D T+++ +G GE+ +LYD +TGIQ G + D+ GW Sbjct: 308 VGQFTYRDRTVTLGDGRMGELTGRLYDMLTGIQYGKLPDQHGW 350 Lambda K H 0.316 0.135 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 439 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 354 Length adjustment: 29 Effective length of query: 334 Effective length of database: 325 Effective search space: 108550 Effective search space used: 108550 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_092053855.1 BQ4888_RS03735 (branched-chain amino acid aminotransferase)
to HMM TIGR01123 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01123.hmm # target sequence database: /tmp/gapView.1009.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01123 [M=313] Accession: TIGR01123 Description: ilvE_II: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-126 408.0 0.0 1.3e-126 407.8 0.0 1.0 1 lcl|NCBI__GCF_900111775.1:WP_092053855.1 BQ4888_RS03735 branched-chain am Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900111775.1:WP_092053855.1 BQ4888_RS03735 branched-chain amino acid aminotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 407.8 0.0 1.3e-126 1.3e-126 1 310 [. 42 351 .. 42 354 .] 0.99 Alignments for each domain: == domain 1 score: 407.8 bits; conditional E-value: 1.3e-126 TIGR01123 1 WdeaelaseaeleldegsavlhYgqevfeGlkayRtadGkillfRpdanakRlrrsaerlllPeleeel 69 W++++++++++l+ld++ avlhY+qe+feGlka+R dG+i lfRp +n +R++rsa r+ +Pel+ + lcl|NCBI__GCF_900111775.1:WP_092053855.1 42 WHSPRIVPYGPLSLDPSCAVLHYAQEIFEGLKAFRRPDGNIALFRPRDNFERFNRSAARMCMPELDVDF 110 ********************************************************************* PP TIGR01123 70 flealkqlvkadkdwvpkakseasLYlRPfliatednlGvkaakeylflvlasPvGaYfkgglapvsif 138 +l+alk l++++ dwvpk ++sLY+RP++iat+++lGv+++++ylf++++sPvGaY+k+g +pv+i+ lcl|NCBI__GCF_900111775.1:WP_092053855.1 111 VLKALKTLIHLESDWVPKSL-GTSLYIRPTMIATDPYLGVHPSSKYLFYIILSPVGAYYKNGFSPVKIY 178 *****************776.************************************************ PP TIGR01123 139 veteyvRaapkGtGavkvgGnYaasllaqkkaaeqglddvvyldpvekkkieevGaaniflitkdgelv 207 +++ yvR+ap+GtG +k+gGnYaasl+a +aa+ g+d+v++ld+ve+k++eevG++ni ++++ g++v lcl|NCBI__GCF_900111775.1:WP_092053855.1 179 ISDGYVRSAPGGTGEAKTGGNYAASLKASMEAAALGFDQVLWLDAVERKYVEEVGSMNICFLYD-GKVV 246 ************************************************************9987.9*** PP TIGR01123 208 ttplsesiLegvtresllelakdlgleveereiaidelkaaveaGei..vfacGtaavitPvgelkieg 274 t+pl + iL+g+tr+s+l l+k+lgl+veer +++de+ + + +G + +f++Gtaav++Pvg+++ + lcl|NCBI__GCF_900111775.1:WP_092053855.1 247 TSPLKGTILDGITRRSILALVKELGLQVEERALSVDEILEGAGNGRLkeAFGTGTAAVVSPVGQFTYRD 315 *********************************************9899******************** PP TIGR01123 275 kevevkseevGevtkklrdeltdiqyGkledkegWi 310 ++v++ ++++Ge+t +l+d lt+iqyGkl d++gW+ lcl|NCBI__GCF_900111775.1:WP_092053855.1 316 RTVTLGDGRMGELTGRLYDMLTGIQYGKLPDQHGWV 351 ***********************************8 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (313 nodes) Target sequences: 1 (354 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.15 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory