Align Acetolactate synthase small subunit; EC 2.2.1.6; Acetohydroxy-acid synthase small subunit; AHAS; ALS (uncharacterized)
to candidate WP_092052742.1 BQ4888_RS01530 ACT domain-containing protein
Query= curated2:Q89AP8 (159 letters) >NCBI__GCF_900111775.1:WP_092052742.1 Length = 143 Score = 40.8 bits (94), Expect = 9e-09 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 3/80 (3%) Query: 1 MKHRILSILLENESGALSRVVGLFSQRGYNIESITVAPTEDLSISKITI-QTFGDKKVIE 59 MK +SI +EN+SG L+ V + + G NI ++++A T D I ++ + +T K V++ Sbjct: 1 MKVEQISIFIENKSGRLAEVTRVLGEAGVNIRALSLADTSDFGILRLIVNKTDEAKAVLK 60 Query: 60 QIGKQLHKLIDVLKVTEIED 79 G ++K DV+ V E+ D Sbjct: 61 SKGFTVNK-TDVVAV-EVPD 78 Lambda K H 0.317 0.136 0.355 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 50 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 159 Length of database: 143 Length adjustment: 16 Effective length of query: 143 Effective length of database: 127 Effective search space: 18161 Effective search space used: 18161 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory