Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate WP_093392973.1 BM091_RS01600 3-dehydroquinate synthase
Query= curated2:B5YHI4 (359 letters) >NCBI__GCF_900114975.1:WP_093392973.1 Length = 386 Score = 237 bits (605), Expect = 3e-67 Identities = 133/343 (38%), Positives = 197/343 (57%), Gaps = 11/343 (3%) Query: 3 KLRVELG---ERSYEILIDRGNLSLIGERLLRFSISKKIGIISNPKVSELYGQKVISSLQ 59 KL V L RSYE++ + G + + S +++ + + V L+G + +++ + Sbjct: 25 KLNVVLSGGESRSYEVMCESGLHRRLDRIIKDLSRGRRVFCVWDRFVHGLWGHRCLTATE 84 Query: 60 KEGFEPFVILIPDGEHYKDYFWAYHILTQLLEFGFDRGSFLIALGGGVIGDITGFVASIY 119 I+ E K + +L+ G DR S L+A+GGGV GD+ GF+ASIY Sbjct: 85 S-------IVWDASEQNKKLSAVEELARELVRRGADRHSLLVAVGGGVTGDVVGFLASIY 137 Query: 120 MRGISYIQIPTTLLAQVDSSVGGKTAVNHPLGKNMIGTFWQPSLVWIDVDTLESLPEREF 179 MRGI +QIPTTL+AQVDSSVGGKT V+ P GKN++GTF QP V ID D L++L E F Sbjct: 138 MRGIPVVQIPTTLVAQVDSSVGGKTGVDLPEGKNLLGTFHQPLWVGIDPDFLQTLSEENF 197 Query: 180 ISGLAEVIKYGVIWDKEFFEFLEINRTKILKKDKDILISIIKRACEIKAEVVSKDERESA 239 G+AEVIK I D + FL N IL++ D++ ++ R EIKA +V +DE+E Sbjct: 198 REGMAEVIKTAWIGDADLVRFLLDNSDDILRRRADVMAHVVFRCVEIKAGIVMEDEKEGG 257 Query: 240 LRAILNYGHTIGHAIETLTGYSSYLHGEAISIGMVHEAKLSSMLGFLDKEDFEKIRNILK 299 +R +LN GHT GHA+E ++ Y + HG A+++G++ L LG+LD+E ++++L Sbjct: 258 VRKVLNLGHTFGHAVERISNY-TINHGHAVAMGLICAGILGRQLGYLDREHLNMLKDLLS 316 Query: 300 EFGLPVNLPINMDSSAMLKTILLDKKNIEGKIRMVIPDSIGKM 342 +GLP LP M+ DKK + + VIP GK+ Sbjct: 317 AYGLPTGLPSEYSPDKMMSVFQADKKKVGNSLVFVIPGPPGKV 359 Lambda K H 0.320 0.141 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 369 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 359 Length of database: 386 Length adjustment: 30 Effective length of query: 329 Effective length of database: 356 Effective search space: 117124 Effective search space used: 117124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate WP_093392973.1 BM091_RS01600 (3-dehydroquinate synthase)
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.15571.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.6e-107 343.2 0.0 1e-106 343.0 0.0 1.1 1 lcl|NCBI__GCF_900114975.1:WP_093392973.1 BM091_RS01600 3-dehydroquinate s Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900114975.1:WP_093392973.1 BM091_RS01600 3-dehydroquinate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 343.0 0.0 1e-106 1e-106 6 339 .. 43 369 .. 38 374 .. 0.91 Alignments for each domain: == domain 1 score: 343.0 bits; conditional E-value: 1e-106 TIGR01357 6 gegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvakll 72 ++gl+++l + +++ + ++++ + d+ v+ l +++ + a + +v + e++K+l+ v++l lcl|NCBI__GCF_900114975.1:WP_093392973.1 43 ESGLHRRLDRIIKDlsRGRRVFCVWDRFVHGLWGHRCLTATE-------SIVWDASEQNKKLSAVEELA 104 555555555555554334666666666666666666665555.......59999*************** PP TIGR01357 73 dqlleeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNli 141 ++l++++++r+s+lva+GGGv gD++GF+A++y+RGi++vq+PTtl+a+vDssvGGKtg++lp+gkNl+ lcl|NCBI__GCF_900114975.1:WP_093392973.1 105 RELVRRGADRHSLLVAVGGGVTGDVVGFLASIYMRGIPVVQIPTTLVAQVDSSVGGKTGVDLPEGKNLL 173 ********************************************************************* PP TIGR01357 142 GafyqPkaVlidlkvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrs 210 G+f+qP V id+++l+tl+e+++reGmaEviK++ i da+l+++l +n++++l++ + ++++++++r+ lcl|NCBI__GCF_900114975.1:WP_093392973.1 174 GTFHQPLWVGIDPDFLQTLSEENFREGMAEVIKTAWIGDADLVRFLLDNSDDILRR-RADVMAHVVFRC 241 ***************************************************99986.56********** PP TIGR01357 211 ievKaevVeeDekesglRalLNfGHtlgHaiEallkyklsHGeaVaiGmvveaklseklgllkaeller 279 +e+Ka +V+eDeke g+R++LN+GHt+gHa+E +++y+++HG+aVa+G++++ l ++lg+l++e l+ lcl|NCBI__GCF_900114975.1:WP_093392973.1 242 VEIKAGIVMEDEKEGGVRKVLNLGHTFGHAVERISNYTINHGHAVAMGLICAGILGRQLGYLDREHLNM 310 ********************************************************************* PP TIGR01357 280 lvallkklglptklkkklsveellkallkDKKnegskiklvlleeiGkaalasevteeel 339 l++ll+++glpt l++++s ++++++++ DKK+ g+++ +v++ Gk++ + ++ +++l lcl|NCBI__GCF_900114975.1:WP_093392973.1 311 LKDLLSAYGLPTGLPSEYSPDKMMSVFQADKKKVGNSLVFVIPGPPGKVIWK-TIEDKKL 369 *********************************************9999988.7766665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 13.07 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory