Align Shikimate kinase; Short=SK; EC 2.7.1.71 (characterized, see rationale)
to candidate WP_093396333.1 BM091_RS12820 shikimate kinase
Query= uniprot:AROK_DESVH (175 letters) >NCBI__GCF_900114975.1:WP_093396333.1 Length = 205 Score = 121 bits (303), Expect = 9e-33 Identities = 63/156 (40%), Positives = 92/156 (58%), Gaps = 1/156 (0%) Query: 4 EVCRVFLIGGRASGKSTVGRALAARLGWDFADTDAMVTRRAGCDIATLVAERGWDAFRDM 63 EV R+ L+G RA+GK+T+G +A R+ W F D D M+T R G I++ V++ GWD+FR Sbjct: 26 EVVRIALVGYRATGKTTLGALVARRINWSFVDMDEMLTGRFGMSISSWVSKHGWDSFRKQ 85 Query: 64 ESDALRDAAARERVVVATGGGMVLRAENRALLREAGVTVFLSLPVEVVAARLARNPEH-G 122 ES L++ + + +VVATGGG+V +NR LLR A +L ++ RL + Sbjct: 86 ESALLQELSQKRNLVVATGGGIVEDPKNRTLLRNAFFVFWLRAQPREISRRLVNDSSSTN 145 Query: 123 QRPSLTGKAVADEVADVMRERAPLYAEAARHVVRGD 158 RPSLTG + +EV V++ R P Y A V+ D Sbjct: 146 NRPSLTGMGITEEVETVLKRREPFYRSVAHAVIDTD 181 Lambda K H 0.322 0.134 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 81 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 175 Length of database: 205 Length adjustment: 20 Effective length of query: 155 Effective length of database: 185 Effective search space: 28675 Effective search space used: 28675 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory