Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_093395028.1 BM091_RS08615 pyridoxal phosphate-dependent aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_900114975.1:WP_093395028.1 Length = 385 Score = 230 bits (586), Expect = 6e-65 Identities = 140/375 (37%), Positives = 201/375 (53%), Gaps = 9/375 (2%) Query: 14 FYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPEL 73 F VMDV A E ++ D+++L G+P P P++ A AL + Y+ +LGI EL Sbjct: 12 FIVMDVLEKAQELEKRGCDIIHLEIGEPDFDTPLPIKQAGIRALEAGETHYTHSLGIQEL 71 Query: 74 RDAIAADYQRRHGIT-VEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNIL 132 R+AI +Y+ +GI ++PD VVIT+G+S FL+A A + GD + + +P YPCY N Sbjct: 72 REAICRNYEAEYGIYGLDPDQVVITSGTSPAFLVALGAVLEPGDELIITNPCYPCYPNFA 131 Query: 133 SALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASW 191 LG + + FQ + + I P +G+++ SPANPTG ++ + L +A Sbjct: 132 RFLGIIPKFVKVYEEEGFQYRIEDVKNAIGPRTKGILINSPANPTGHLLDADRLKGLAGL 191 Query: 192 CDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTV 251 + + SDE+YHGLVY G S T + V N FSK YAMTGWRLG++++P Sbjct: 192 ----GLWIFSDEIYHGLVYDGERAHSILEFTDK-CFVFNGFSKKYAMTGWRLGYVIIPKP 246 Query: 252 LRRAVDCLTGNFTICPPVLSQIAAVSAFTPE-ATAEADGNLASYAINRSLLLDGLRRIGI 310 +R V C+ NF I SQ AA+ A T + E + Y R ++ L+ IG Sbjct: 247 FKRTVQCMVQNFFISANAASQRAALVALTDDRVVTETKKMVDEYDRRRKFMISRLKEIGF 306 Query: 311 DRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGP 370 GAFYV+A+ F SDS +LL V +APGIDF T G ++R S+A Sbjct: 307 GIDHEPKGAFYVFANAKSFGSDSYRLAFELLEQAHVGVAPGIDFGT-NGEGYLRFSYANS 365 Query: 371 SGDIEEALRRIGSWL 385 I+EAL RI +L Sbjct: 366 IEKIDEALNRIAQYL 380 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 363 Number of extensions: 16 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 385 Length adjustment: 30 Effective length of query: 358 Effective length of database: 355 Effective search space: 127090 Effective search space used: 127090 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory