Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate WP_092484432.1 BM299_RS11865 hydroxyacid dehydrogenase
Query= curated2:Q58424 (524 letters) >NCBI__GCF_900115975.1:WP_092484432.1 Length = 314 Score = 291 bits (744), Expect = 3e-83 Identities = 158/313 (50%), Positives = 219/313 (69%), Gaps = 4/313 (1%) Query: 2 VKILVTDPLHEDAIKILEEVGEVEVATGL-TKEELLEKIKDADVLVVRSGTKVTRDVIEK 60 +K ++T+ + +IL E+GEV L K+EL + I DA+ L+VR+ TKV+R +++ Sbjct: 1 MKTVITELNWKQGNEILSEMGEVIYDPELWRKKELPDIIHDAEALIVRNQTKVSRTLLDS 60 Query: 61 AEKLKVIGRAGVGVDNIDVEAATEKGIIVVNAPDASSISVAELTMGLMLAAARNIPQATA 120 A KL+VIGR GVG+DNID++A +KGI VV A +A++ISV E +ML AR+ +AT Sbjct: 61 APKLRVIGRLGVGLDNIDLQATKDKGISVVYARNANAISVVEYVFAVMLTFARHPVEATT 120 Query: 121 SLKRGEWDRKRFKGIELYGKTLGVIGLGRIGQQVVKRAKAFGMNIIGYDPYIPK-EVA-E 178 +KRG W+RK F G ELYGKTLG+IG+G IG ++ RAKAFGM+++GYDP++P E+A Sbjct: 121 DVKRGNWNRKLFTGSELYGKTLGLIGIGEIGTRLAARAKAFGMHLLGYDPFLPPYEIAIA 180 Query: 179 SMGVELVDDINELCKRADFITLHVPLTPKTRHIIGREQIALMKKNAIIVNCARGGLIDEK 238 GVE ++ + +RADFI+LHVPL TRH+I ++ + L+K A I+N ARGG+IDE+ Sbjct: 181 DFGVEQA-NLEGVIRRADFISLHVPLNKATRHLINKQTLELVKSTAYIINSARGGVIDEQ 239 Query: 239 ALYEALKEGKIRAAALDVFEEEPPKDNPLLTLDNVIGTPHQGASTEEAQKAAGTIVAEQI 298 ALYEAL KI AALDV E+EPP ++PLL LDNVI TPH TEEAQ +VA ++ Sbjct: 240 ALYEALSNKKIAGAALDVLEQEPPTNSPLLKLDNVILTPHIAGLTEEAQVKTSVLVAREV 299 Query: 299 KKVLRGELAENVV 311 KV +G+ + VV Sbjct: 300 IKVFQGQQSSCVV 312 Lambda K H 0.316 0.137 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 524 Length of database: 314 Length adjustment: 31 Effective length of query: 493 Effective length of database: 283 Effective search space: 139519 Effective search space used: 139519 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory