Align Ketol-acid reductoisomerase (NAD(P)(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; Ketol-acid reductoisomerase type 1; Ketol-acid reductoisomerase type I; EC 1.1.1.383 (characterized)
to candidate WP_092483008.1 BM299_RS08295 ketol-acid reductoisomerase
Query= SwissProt::Q0AV19 (337 letters) >NCBI__GCF_900115975.1:WP_092483008.1 Length = 331 Score = 481 bits (1238), Expect = e-140 Identities = 240/335 (71%), Positives = 278/335 (82%), Gaps = 5/335 (1%) Query: 1 MARMFYDADANLENLKGKTIAVMGFGSQGHAQAQNLKESGLNVIVGLRKPFDEASEKEWN 60 M ++FYD DA+L LKGK IAVMGFGSQGHAQ+QNLKESGL+V+VGLRK D AS W Sbjct: 1 MVKVFYDQDADLAVLKGKKIAVMGFGSQGHAQSQNLKESGLDVVVGLRK--DSAS---WA 55 Query: 61 AVIAAGITPMSVAEAAEAADVIQILLPDEVQARVYNAEIKPYLKAGNALGFSHGFNIHFG 120 AAG+ +VAEAA AD+IQILLPDE QARVY EI+PYL G AL FSHGFNIHFG Sbjct: 56 RAEAAGLQVATVAEAAGQADIIQILLPDEYQARVYKEEIEPYLTEGKALMFSHGFNIHFG 115 Query: 121 QIVPPAFVDVFMVAPKSPGHLVRRMYVKGAGVPGLVAVQQDYSGKAKDLALAYACGIGCT 180 QIVPP VDVF+VAPKSPGHLVRRMYV G GVPGLVAV QDY+G+A+D+ +AYA GIGCT Sbjct: 116 QIVPPNNVDVFLVAPKSPGHLVRRMYVDGQGVPGLVAVHQDYTGRARDITMAYAKGIGCT 175 Query: 181 RAGVIETSFQEETETDLFGEQCVLCGGVTELVKAGFETLVEAGYQPEIAYFECMHELKLI 240 RAGV ET+F EETETDLFGEQCVLCGGV+EL+KAGFETLVEAGY PE+AYFEC+HELKLI Sbjct: 176 RAGVFETTFAEETETDLFGEQCVLCGGVSELIKAGFETLVEAGYAPEMAYFECLHELKLI 235 Query: 241 VDLMYEGGMSYMRYSISDTAEWGDYTKGPEIIGEEARYAMYEALQDIQDGSFAKGWLLEN 300 VDL+ EGG+++MR+SIS+TAE+GDY GP II E+ R M LQ+IQDG FAK W+LEN Sbjct: 236 VDLINEGGLTWMRHSISNTAEYGDYITGPRIINEDTREEMRAVLQEIQDGVFAKEWILEN 295 Query: 301 MVGRPRFNALKRQNREHLIEEVGAELRGMMPWLKE 335 RP +NA+K++ +EH IE+VGAELR MMPWLK+ Sbjct: 296 QANRPVYNAIKKREQEHPIEQVGAELRQMMPWLKK 330 Lambda K H 0.319 0.136 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 421 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 337 Length of database: 331 Length adjustment: 28 Effective length of query: 309 Effective length of database: 303 Effective search space: 93627 Effective search space used: 93627 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_092483008.1 BM299_RS08295 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.10866.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-147 476.8 0.1 1.5e-147 476.6 0.1 1.0 1 lcl|NCBI__GCF_900115975.1:WP_092483008.1 BM299_RS08295 ketol-acid reducto Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900115975.1:WP_092483008.1 BM299_RS08295 ketol-acid reductoisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 476.6 0.1 1.5e-147 1.5e-147 1 314 [] 15 329 .. 15 329 .. 0.99 Alignments for each domain: == domain 1 score: 476.6 bits; conditional E-value: 1.5e-147 TIGR00465 1 lkgkkvaiiGyGsqGeaqalnlrdsglnvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpD 69 lkgkk+a++G+GsqG+aq+ nl++sgl+v+vglrk++asw++Ae G++v tv+ea+ +ad+i iLlpD lcl|NCBI__GCF_900115975.1:WP_092483008.1 15 LKGKKIAVMGFGSQGHAQSQNLKESGLDVVVGLRKDSASWARAEAAGLQVATVAEAAGQADIIQILLPD 83 79******************************************************************* PP TIGR00465 70 evqkevyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliA 138 e q +vy++ei+p+l+egkal+fsHGfni+f qiv+p++vdv+lvAPK+pG+lvR++y g+Gvp+l+A lcl|NCBI__GCF_900115975.1:WP_092483008.1 84 EYQARVYKEEIEPYLTEGKALMFSHGFNIHFGQIVPPNNVDVFLVAPKSPGHLVRRMYVDGQGVPGLVA 152 ********************************************************************* PP TIGR00465 139 veqdvtgeakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqp 207 v+qd+tg a++i +ayAk+iG +ragv+ettF eE+e+DLfGEq vLcGg+++lika+f+tLveaGy+p lcl|NCBI__GCF_900115975.1:WP_092483008.1 153 VHQDYTGRARDITMAYAKGIGCTRAGVFETTFAEETETDLFGEQCVLCGGVSELIKAGFETLVEAGYAP 221 ********************************************************************* PP TIGR00465 208 elAyfeivhelklivdllkekGlelmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGefake 275 e+Ayfe++helklivdl++e+Gl+ mr+++sntA++g++ ++ +i++e +++em+ +l+eiq+G fake lcl|NCBI__GCF_900115975.1:WP_092483008.1 222 EMAYFECLHELKLIVDLINEGGLTWMRHSISNTAEYGDYITGpRIINEDTREEMRAVLQEIQDGVFAKE 290 ****************************************999************************** PP TIGR00465 276 walekeagkpafeearkkekeqeiekvGkelralvkaek 314 w+le++a++p +++++k+e+e+ ie+vG elr+++++ k lcl|NCBI__GCF_900115975.1:WP_092483008.1 291 WILENQANRPVYNAIKKREQEHPIEQVGAELRQMMPWLK 329 ***********************************9975 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (331 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 7.74 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory