Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25) (characterized)
to candidate WP_074200494.1 BUQ81_RS00770 shikimate dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >NCBI__GCF_900141795.1:WP_074200494.1 Length = 278 Score = 257 bits (656), Expect = 2e-73 Identities = 152/277 (54%), Positives = 183/277 (66%), Gaps = 7/277 (2%) Query: 2 DQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDE--FSDCARGFFKQGSGG-N 58 D+Y V G PI HSKSPLIHRLFAEQTG+DL Y +L DE F+ R G G N Sbjct: 3 DKYAVVGYPIAHSKSPLIHRLFAEQTGEDLVYEAILIDADEKPFAAAVRELMALGYRGLN 62 Query: 59 VTVPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELA 118 VTVP+K +AF D+LT RA A AVNTL+ +G L GDNTDG GLV+D+ AGV L Sbjct: 63 VTVPYKLDAFEFADTLTDRADIAQAVNTLTFTDEGVL-GDNTDGVGLVQDIEELAGVSLR 121 Query: 119 GKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVASGFAWLQ 178 GK +LILGAGGAV+GVL P+LA P S+ IANRT +AE LAR F + + A Sbjct: 122 GKSVLILGAGGAVQGVLHPLLAADPNSIFIANRTAGRAEALARRFADARVSGGTFEAIPD 181 Query: 179 EPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGA-AKVLD 237 P DVIIN T+ASL G+LPPI +++ G ++ YDMMY EPT F +WA++ V D Sbjct: 182 TPFDVIINGTAASLEGKLPPIPTAVI-GGNSLVYDMMYAAEPTVFLRWASETQPNCTVRD 240 Query: 238 GLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQLARG 274 GLGML QAAEAF WRGVRP +APVL E R++ RG Sbjct: 241 GLGMLVCQAAEAFASWRGVRPQSAPVL-EAVRKIIRG 276 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 278 Length adjustment: 25 Effective length of query: 249 Effective length of database: 253 Effective search space: 62997 Effective search space used: 62997 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate WP_074200494.1 BUQ81_RS00770 (shikimate dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.25237.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.6e-78 248.4 0.0 4.1e-78 248.2 0.0 1.0 1 lcl|NCBI__GCF_900141795.1:WP_074200494.1 BUQ81_RS00770 shikimate dehydrog Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900141795.1:WP_074200494.1 BUQ81_RS00770 shikimate dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 248.2 0.0 4.1e-78 4.1e-78 2 268 .. 4 273 .. 3 275 .. 0.94 Alignments for each domain: == domain 1 score: 248.2 bits; conditional E-value: 4.1e-78 TIGR00507 2 llgviGnpikhSksplihnaalkqlgleleYlafeveiee..lekalsgikalglkGvnvTvPfKeevl 68 ++v+G+pi+hSksplih +++q+g +l+Y a+ ++ +e + a+ ++ alg +G+nvTvP+K ++ lcl|NCBI__GCF_900141795.1:WP_074200494.1 4 KYAVVGYPIAHSKSPLIHRLFAEQTGEDLVYEAILIDADEkpFAAAVRELMALGYRGLNVTVPYKLDAF 72 59*******************************9999888789************************** PP TIGR00507 69 ellDeieesakligavNTlkledgklvgynTDgiGlvssLekls..klksekrvliiGAGGaakavale 135 e++D ++++a ++avNTl+ d+ ++g+nTDg+Glv+++e+l l+ +k+vli+GAGGa ++v+ + lcl|NCBI__GCF_900141795.1:WP_074200494.1 73 EFADTLTDRADIAQAVNTLTFTDEGVLGDNTDGVGLVQDIEELAgvSLR-GKSVLILGAGGAVQGVLHP 140 ******************************************6511445.9****************** PP TIGR00507 136 Llka.dkeviiaNRtvekaeelaerlqelgeilalsleevelkkvdliinatsaglsgeideaevkael 203 Ll a ++++ iaNRt +ae+la r++ + e ++ +d+iin t+a+l+g++ +++++ + lcl|NCBI__GCF_900141795.1:WP_074200494.1 141 LLAAdPNSIFIANRTAGRAEALARRFAD-ARVSGGTFEAIPDTPFDVIINGTAASLEGKL--PPIPTAV 206 **997899*******************9.56666677899999*****************..******* PP TIGR00507 204 lkegklvvDlvynpletpllkeakkkg..tkvidGlgMlvaQaalsFelwtgvepdvekvfealkek 268 + ++lv+D++y+ t++l++a++ + + v dGlgMlv Qaa +F w+gv p+ v ea+++ lcl|NCBI__GCF_900141795.1:WP_074200494.1 207 IGGNSLVYDMMYAAEPTVFLRWASETQpnCTVRDGLGMLVCQAAEAFASWRGVRPQSAPVLEAVRKI 273 ***********************99876799***************************999999876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (278 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.30 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory