Align ATP-dependent reduction of co(II)balamin (characterized)
to candidate WP_072906133.1 BUB13_RS04880 DUF4445 domain-containing protein
Query= reanno::DvH:206336 (543 letters) >NCBI__GCF_900142125.1:WP_072906133.1 Length = 409 Score = 149 bits (376), Expect = 2e-40 Identities = 136/432 (31%), Positives = 198/432 (45%), Gaps = 42/432 (9%) Query: 123 LAVDLGTTSLQWSLLAPDGTVAAQGSETNPQMGAGSDVMSRIAMARSDKGRGRLRELVLQ 182 L +DLGTTSL + +G V A+ S NPQ G+DV++R+ A +L+ L++ Sbjct: 6 LGLDLGTTSLIGRIWTTEGQVVAEASCDNPQQQFGADVIARMEAALKGAA-DQLQALLVD 64 Query: 183 ALRRIVADVEGTPATADAVPPAGSGDEPTTACGYESRVEELCVAGNTAMTAILADESVEG 242 + R++AD+ G EP + A N A++ +L ESVE Sbjct: 65 GINRLIADLLKQV-----------GAEP-------GWISAAAAAANPAISLLLVRESVEN 106 Query: 243 LASAPYRLEMRGGTALALPGL-----PPAWIPPLPAPFVGGDLSAGYLAVLTDHAPAFPF 297 + PYR + R G AL L P + PL + +VGGDL A +L D P Sbjct: 107 VLQPPYRPDYRAGEALGSGKLGIDLPAPLLLLPLVSGYVGGDLLA---LLLADPPKDGPT 163 Query: 298 VLADLGTNGEFVLALSPERTLVTSVALGPALEGIGLTFGTVAQRGAITSFTLTPGGLVPY 357 + DLGTN E L + LVTSVA GPA E L G GA+T + V Sbjct: 164 LYLDLGTNAELAL-WDGDSWLVTSVAAGPAFEAGNLGCGMRHGFGAVTEVGVLRDRFVYT 222 Query: 358 VLDGGEADGISGTGYISLVHALLRAGLLDVDGRFIQSPSSPLAARMARSIVSHRGEPCLP 417 V GG GI G+G SL+ +++GL+ +DGR +S + + ++R +V+ P L Sbjct: 223 VAGGGTPKGICGSGLFSLLSRAIQSGLIAIDGRI--KEASEVDSNLSRYLVADENGPALQ 280 Query: 418 LARG----LYLAARDIEEILKVKAAFSLAFERLLATAQMPSHALSGIHLAGALGQHALPA 473 L R L L D+ K A LL + + L+ + LAGALG ALPA Sbjct: 281 LYRDARTCLRLTQDDVRAFQLAKGAVLAGVNCLLERKGIQAEQLASVRLAGALG-GALPA 339 Query: 474 D-LEGLGFIPPGSGGRTRAVGNTSLRGAELLLTSPPLRDTLNTWREGCTVV---DLTAAP 529 + L+G+ +P + R + L G + +L +D L R+ T + L+ P Sbjct: 340 EALKGVALLPENVIDKCRFLPGAVLIGLQRVLQR---KDGLEQARQLATELKPYPLSGTP 396 Query: 530 DFSAAFLRHMHF 541 F AFL + F Sbjct: 397 AFEKAFLGSLDF 408 Lambda K H 0.320 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 544 Number of extensions: 34 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 543 Length of database: 409 Length adjustment: 33 Effective length of query: 510 Effective length of database: 376 Effective search space: 191760 Effective search space used: 191760 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate WP_072906133.1 BUB13_RS04880 (DUF4445 domain-containing protein)
to HMM PF14574 (RACo_C_ter)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF14574.10.hmm # target sequence database: /tmp/gapView.7371.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: RACo_C_ter [M=261] Accession: PF14574.10 Description: C-terminal domain of RACo the ASKHA domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.4e-51 159.9 0.1 8.3e-51 158.6 0.0 1.6 2 lcl|NCBI__GCF_900142125.1:WP_072906133.1 BUB13_RS04880 DUF4445 domain-con Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900142125.1:WP_072906133.1 BUB13_RS04880 DUF4445 domain-containing protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.1 1.5 0.18 0.18 20 33 .. 82 95 .. 79 96 .. 0.88 2 ! 158.6 0.0 8.3e-51 8.3e-51 3 247 .. 163 406 .. 161 409 .] 0.92 Alignments for each domain: == domain 1 score: -3.1 bits; conditional E-value: 0.18 RACo_C_ter 20 dwllaasaaaGPAl 33 w+ aa+aaa PA+ lcl|NCBI__GCF_900142125.1:WP_072906133.1 82 GWISAAAAAANPAI 95 6999********97 PP == domain 2 score: 158.6 bits; conditional E-value: 8.3e-51 RACo_C_ter 3 slliDiGTNaEivlgnkdwllaasaaaGPAlEGgeikcGmrAapgAierveidpetlevelkvignekp 71 +l++D+GTNaE++l + d l++s aaGPA+E g++ cGmr gA+ +v + ++ + ++v g+ +p lcl|NCBI__GCF_900142125.1:WP_072906133.1 163 TLYLDLGTNAELALWDGDSWLVTSVAAGPAFEAGNLGCGMRHGFGAVTEVGVLRDR--FVYTVAGGGTP 229 899*************************************************9998..99********* PP RACo_C_ter 72 kGicGsGiidliaelleagiidkkgklnkel.....kserireeeeteeyvlvlaeesetekdivitek 135 kGicGsG+ +l+++++++g+i +g++++ s+ + ++e+ +++ l+ + ++ + +t+ lcl|NCBI__GCF_900142125.1:WP_072906133.1 230 KGICGSGLFSLLSRAIQSGLIAIDGRIKEASevdsnLSRYLVADENGPALQLYRDA----RTCLRLTQD 294 ***************************88764433223334456677777776654....3479***** PP RACo_C_ter 136 DidelirakaAiyagvktLleevglevedidkvylaGafGsyidlekAitiGllPdlelekvkqvGNts 204 D+++++ ak+A+ agv++Lle+ g+++e++ +v laGa G + +e + llP+ ++k +++ + lcl|NCBI__GCF_900142125.1:WP_072906133.1 295 DVRAFQLAKGAVLAGVNCLLERKGIQAEQLASVRLAGALGGALPAEALKGVALLPENVIDKCRFLPGAV 363 ********************************************************************* PP RACo_C_ter 205 lagAraallsreareeleeiarkityielavekkFmeefvaal 247 l g + +l ++ +e+++++a++++ l+ +++F++ f+ +l lcl|NCBI__GCF_900142125.1:WP_072906133.1 364 LIGLQRVLQRKDGLEQARQLATELKPYPLSGTPAFEKAFLGSL 406 ***************************************9876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (261 nodes) Target sequences: 1 (409 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.10 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory