Align Phosphoserine phosphatase RsbU; EC 3.1.3.3; Sigma factor SigB regulation protein RsbU (uncharacterized)
to candidate WP_072905123.1 BUB13_RS02305 stage II sporulation protein E
Query= curated2:P40399 (335 letters) >NCBI__GCF_900142125.1:WP_072905123.1 Length = 1072 Score = 145 bits (367), Expect = 4e-39 Identities = 83/257 (32%), Positives = 150/257 (58%), Gaps = 6/257 (2%) Query: 82 MAYQEHQTLRGIQQ--EIKSEIEIAANVQQTLLGTKVPQEEALDIGAISVPAKQMSGDYY 139 +A++ + L+G+ + E + E++IA N+Q +LL ++P+ E + + + VPA Q+ GDY+ Sbjct: 813 LAWRNDEQLQGLLEVHEQEREMQIAKNIQSSLLPAELPEMEEISVAGLCVPAHQIGGDYF 872 Query: 140 HFV-KDKESINIAIADVIGKGIPAALCMSMIKYAMDSLPETGIHPSQVLKNLNRVVEQNV 198 ++ +D ++ IADV G I +AL M+ + + + ++ PS +L +LNR N+ Sbjct: 873 DYLPRDGSCFDLIIADVSGHNIGSALIMAETRTFIHARADSLRQPSDMLHSLNRFFFDNM 932 Query: 199 DAS-MFITMFYANYNMDKHQFTYASAGHEPGFYYSQKDNTFYDLEAKGLVLGISQDYDYK 257 D S +F+TMFY Y DK +Y+SAGH + +K+ L+A+GL+ GI D ++ Sbjct: 933 DCSDLFVTMFYVQYCPDKRTLSYSSAGHNHPLLWREKEQKVDPLDAEGLIFGIKPDVAFE 992 Query: 258 QFDQHLEKGDMIVLFSDGVTECRTENG-FLERPDLQKLIEEHMCSSAQEMVKNIYDSLLK 316 Q L KGD+++L++DG+ E +G F L KL++E ++QE+++ I + + Sbjct: 993 QNSTPLGKGDILLLYTDGIIEAEDSSGEFFGMERLGKLLQEAGNLTSQEIIERIMNQVRI 1052 Query: 317 LQDFQ-LHDDFTLIVLR 332 + DD TL+V++ Sbjct: 1053 FTGLRHFKDDITLVVMK 1069 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 698 Number of extensions: 37 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 1072 Length adjustment: 37 Effective length of query: 298 Effective length of database: 1035 Effective search space: 308430 Effective search space used: 308430 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory