Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate WP_072909464.1 BUB13_RS14345 3-phosphoserine/phosphohydroxythreonine transaminase
Query= BRENDA::Q9SHP0 (422 letters) >NCBI__GCF_900142125.1:WP_072909464.1 Length = 362 Score = 327 bits (838), Expect = 4e-94 Identities = 171/363 (47%), Positives = 236/363 (65%), Gaps = 5/363 (1%) Query: 62 RVINFAAGPAALPENVLLKAQSDLYNWRGSGMSVMEMSHRGKEFLSIIQKAESDLRQLLE 121 +V NF AGPA LPE+V+ + + + ++ G G+S++E+SHR KEF ++ KA+ D R+L Sbjct: 3 KVFNFGAGPAMLPESVMQQIREEWLDFSGMGVSIIEISHRAKEFEQVLLKAQDDFRKLTN 62 Query: 122 IPSEYSVLFLQGGATTQFAALPLNLCKSDDSVD--YIVTGSWGDKAFKEAKKYCNPKVIW 179 +P Y +LF+ GGA QF+ALPLNL + +S Y+ TG++ A K+A +C+ KVI Sbjct: 63 LPENYKILFIHGGARMQFSALPLNLARRSESKKCLYVETGNFAKLANKDAAAFCDVKVIA 122 Query: 180 SGKSEKYTKVPTFDGLEQSSDAKYLHICANETIHGVEFKDYPLVENPDGVLIADMSSNFC 239 S Y ++P DA YLHI N TI+G + +P E LIAD +S Sbjct: 123 SSADTNYDRIPEITPEMVDQDAAYLHITTNNTIYGSRYNSFP--ETGAVPLIADQTSEIL 180 Query: 240 SKPVDVSKFGVIYAGAQKNVGPSGVTIVIIRKDLIGNARDITPVMLDYKIHDENSSLYNT 299 S+ VD SKFG IYAG QKN+GPSG IV+IR+DL+G A + TP +L+Y D+++SL NT Sbjct: 181 SRVVDYSKFGCIYAGLQKNLGPSGTAIVVIREDLLGQAAEKTPTLLNYTQADKDNSLTNT 240 Query: 300 PPCFGIYMCGLVFDDLLEQGGLKEVEKKNQRKAELLYNAIDESRGFFRCPVEKSVRSLMN 359 F IY GLV LL+QGG+ +EK+N+ KA++LY+ ID S +FR + R MN Sbjct: 241 ANTFAIYTTGLVLQWLLDQGGVAAIEKQNEAKAKVLYDLIDSS-DYFRGVILPEFRGTMN 299 Query: 360 VPFTLEKSELEAEFIKEAAKEKMVQLKGHRSVGGMRASIYNAMPLAGVEKLVAFMKDFQA 419 V F L +ELEA+F+KEA + LKGHRSVGG+RASIYNAMP+AGVE L FM+DF Sbjct: 300 VSFNLPTAELEAQFLKEAGAANLYALKGHRSVGGIRASIYNAMPMAGVEALANFMQDFAK 359 Query: 420 RHA 422 +++ Sbjct: 360 KNS 362 Lambda K H 0.317 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 422 Length of database: 362 Length adjustment: 31 Effective length of query: 391 Effective length of database: 331 Effective search space: 129421 Effective search space used: 129421 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate WP_072909464.1 BUB13_RS14345 (3-phosphoserine/phosphohydroxythreonine transaminase)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.22769.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-141 457.8 0.0 1.2e-141 457.7 0.0 1.0 1 lcl|NCBI__GCF_900142125.1:WP_072909464.1 BUB13_RS14345 3-phosphoserine/ph Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900142125.1:WP_072909464.1 BUB13_RS14345 3-phosphoserine/phosphohydroxythreonine transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 457.7 0.0 1.2e-141 1.2e-141 1 358 [] 4 361 .. 4 361 .. 0.99 Alignments for each domain: == domain 1 score: 457.7 bits; conditional E-value: 1.2e-141 TIGR01364 1 ivnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlfl 69 ++nF+aGPa+lpe+v++++++e ldf+g+g+s++eisHR+kefe+v+ +a++d+r+L n+p+ny++lf+ lcl|NCBI__GCF_900142125.1:WP_072909464.1 4 VFNFGAGPAMLPESVMQQIREEWLDFSGMGVSIIEISHRAKEFEQVLLKAQDDFRKLTNLPENYKILFI 72 58******************************************************************* PP TIGR01364 70 qGGattqfaavplnllk..ekkvadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeelel 136 GGa+ qf+a+plnl++ e+k++ y+ tG+++k a k+a +++ vkv+as+++++y++ip+ + lcl|NCBI__GCF_900142125.1:WP_072909464.1 73 HGGARMQFSALPLNLARrsESKKCLYVETGNFAKLANKDAAAFCD-VKVIASSADTNYDRIPEITPEMV 140 ****************977778**********************9.*********************** PP TIGR01364 137 kedaayvylcanetieGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvi 205 ++daay+++++n+ti+G +++ pe+ +pl+aD s+ilsr +d sk+g iyaG qKn+Gp+G ++v+ lcl|NCBI__GCF_900142125.1:WP_072909464.1 141 DQDAAYLHITTNNTIYGSRYNSFPETGAVPLIADQTSEILSRVVDYSKFGCIYAGLQKNLGPSGTAIVV 209 ********************************************************************* PP TIGR01364 206 vrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklekknqeKakllYe 274 +r+dll++a +++p++l+Y+ + + +sl nt tfaiy++glvl+wl+++GGv+++ek+n++Kak+lY+ lcl|NCBI__GCF_900142125.1:WP_072909464.1 210 IREDLLGQAAEKTPTLLNYTQADKDNSLTNTANTFAIYTTGLVLQWLLDQGGVAAIEKQNEAKAKVLYD 278 ********************************************************************* PP TIGR01364 275 aidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGiRasiYnalplee 343 +id+s+ ++++ + ++ R +mnv+F+l+ +ele++Flkea +++l +lkGhrsvGGiRasiYna+p+++ lcl|NCBI__GCF_900142125.1:WP_072909464.1 279 LIDSSD-YFRGVILPEFRGTMNVSFNLPTAELEAQFLKEAGAANLYALKGHRSVGGIRASIYNAMPMAG 346 ***885.************************************************************** PP TIGR01364 344 vqaLvdfmkeFekkh 358 v+aL++fm++F+kk+ lcl|NCBI__GCF_900142125.1:WP_072909464.1 347 VEALANFMQDFAKKN 361 ************985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (362 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.59 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory