Align Fructose-bisphosphate aldolase class 1; Fructose-bisphosphate aldolase class I; FBP aldolase; FBPA; EC 4.1.2.13 (characterized)
to candidate WP_078715827.1 B5D49_RS01240 fructose-bisphosphate aldolase
Query= SwissProt::P58315 (263 letters) >NCBI__GCF_900167125.1:WP_078715827.1 Length = 266 Score = 136 bits (343), Expect = 4e-37 Identities = 88/254 (34%), Positives = 137/254 (53%), Gaps = 10/254 (3%) Query: 10 RIFARRG-KSIILAYDHGIEHGPADFMDNPDSADPEYILRLARDAGFDGVVFQRG---IA 65 RIF R ++I++ DHG+ GP + +++ A + + G + V+ +G Sbjct: 11 RIFNRNTHRTIVVPMDHGVTVGPIEGIEDMREAVSRVV-----EGGANAVLEHKGNVRCG 65 Query: 66 EKYYDGSVPLILKLNGKTTLYNGEPVSVANCSVEEAVSLGASAVGYTIYPGSGFEWKMFE 125 + V LI+ L+ T L SVE+AV LGA AV + G E M Sbjct: 66 HRAEGRDVGLIVHLSASTCLSPRPNYKGLVASVEDAVCLGADAVSVHLNLGDDNETDMLR 125 Query: 126 ELARIKRDAVKFDLPLVVWSYPRGGKVVNETAPEIVAYAARIALELGADAMKIKYTGDPK 185 ++ R+ DA ++ +PL+ Y RG KV +E P +VA+ AR+ ELGAD +K+ YTGDP Sbjct: 126 DVGRVATDAARWGMPLLAMVYARGPKVKDEYDPAVVAHCARVGTELGADVVKVNYTGDPD 185 Query: 186 TFSWAVKVAGKVPVLMSGGPKTKTEEDFLKQVEGVLEAGALGIAVGRNVWQRRDALKFAR 245 +FS V A +PV+++GGPK + +FL+ V L AG G++VGRNV+Q K + Sbjct: 186 SFS-RVTGACCIPVVIAGGPKMDSTGEFLQMVRDSLMAGGAGLSVGRNVFQHPRVTKLVQ 244 Query: 246 ALAELVYGGKKLAE 259 AL+ +V+ ++ E Sbjct: 245 ALSMVVHEDMQVDE 258 Lambda K H 0.318 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 221 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 266 Length adjustment: 25 Effective length of query: 238 Effective length of database: 241 Effective search space: 57358 Effective search space used: 57358 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory