Align Branched-chain amino acid aminotransferase (EC 2.6.1.42) (characterized)
to candidate WP_078716504.1 B5D49_RS04595 branched-chain amino acid transaminase
Query= reanno::BFirm:BPHYT_RS16285 (307 letters) >NCBI__GCF_900167125.1:WP_078716504.1 Length = 307 Score = 355 bits (911), Expect = e-103 Identities = 167/302 (55%), Positives = 218/302 (72%) Query: 3 MADRDGKIWMDGKLIDWRDAKIHVLTHTLHYGMGVFEGVRAYKTADGGTAIFRLQEHTKR 62 M + IW DGKL+ W +A +HVLTH LHYG VFEG+RAY+ +G +A+FRLQEH R Sbjct: 1 MVQKSETIWFDGKLVPWDEANVHVLTHALHYGTSVFEGIRAYEGTNGKSAVFRLQEHMDR 60 Query: 63 LLNSAKIFQMDVPFDHETLAAAQCEVVRENKLESCYLRPIIWVGSEKLGVSAKGNTIHVA 122 L++SAKI +D+ ++ E L A + + N L+ Y+RP+++VG+ +GV N +HV Sbjct: 61 LVDSAKIIGLDLKYNSEQLTEATIQTLESNGLKEGYIRPLVFVGAGAMGVHPGANPLHVC 120 Query: 123 IAAWPWGAYLGEDGIAKGIRVKTSSFTRHHVNVSMVRAKASGWYVNSILANQEAIADGYD 182 IAAWPWGAYLGE+ + KGIRVK SSFTRHHVNV M +AK+ G YVNS+LA EA+ADGYD Sbjct: 121 IAAWPWGAYLGEEALEKGIRVKCSSFTRHHVNVMMTKAKSGGNYVNSVLAKTEAVADGYD 180 Query: 183 EALLLDVDGYVSEGSGENFFLVNNGKLYTPDLSSCLDGITRDTVITLARDAGIQVIEKRI 242 EA++LD GYV+EG+GEN F+V + +YTP L + L G TRD+VITLA D G +V E + Sbjct: 181 EAVMLDPQGYVAEGTGENLFMVKDDVIYTPPLHNVLGGFTRDSVITLAGDLGYEVREITM 240 Query: 243 TRDEVYTCDEAFFTGTAAEVTPIRELDNRTIGSGARGPITEKLQSGFFDIVNGKSDKYAN 302 RD +Y DE FFTGTAAE+TP+RE+D R IG G GP+ + LQ+ FF IV G++ YA Sbjct: 241 GRDMLYIADEVFFTGTAAEITPVREVDRRVIGEGKAGPVAKLLQTEFFRIVKGENPDYAL 300 Query: 303 WL 304 WL Sbjct: 301 WL 302 Lambda K H 0.319 0.136 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 346 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 307 Length of database: 307 Length adjustment: 27 Effective length of query: 280 Effective length of database: 280 Effective search space: 78400 Effective search space used: 78400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
Align candidate WP_078716504.1 B5D49_RS04595 (branched-chain amino acid transaminase)
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01122.hmm # target sequence database: /tmp/gapView.2556.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01122 [M=298] Accession: TIGR01122 Description: ilvE_I: branched-chain amino acid aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.6e-137 442.9 0.0 2.9e-137 442.7 0.0 1.0 1 lcl|NCBI__GCF_900167125.1:WP_078716504.1 B5D49_RS04595 branched-chain ami Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900167125.1:WP_078716504.1 B5D49_RS04595 branched-chain amino acid transaminase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 442.7 0.0 2.9e-137 2.9e-137 1 296 [. 9 303 .. 9 305 .. 0.98 Alignments for each domain: == domain 1 score: 442.7 bits; conditional E-value: 2.9e-137 TIGR01122 1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdk.glaifrlkehveRlydsakilrleipyske 68 w+dG+lv++++a+vhvlthalhYGt+vfeGiRaYe+ + ++a+frl+eh++Rl dsaki+ l+++y +e lcl|NCBI__GCF_900167125.1:WP_078716504.1 9 WFDGKLVPWDEANVHVLTHALHYGTSVFEGIRAYEGTNgKSAVFRLQEHMDRLVDSAKIIGLDLKYNSE 77 9**********************************9994579*************************** PP TIGR01122 69 elvevtkevlrknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvss 137 +l+e+t+++l +n+lk+ YiRplv+vGa+ +g++p + +v+iaaw+wgaylgeealekGi+vk ss lcl|NCBI__GCF_900167125.1:WP_078716504.1 78 QLTEATIQTLESNGLKEGYIRPLVFVGAGAMGVHP-GANPLHVCIAAWPWGAYLGEEALEKGIRVKCSS 145 ***********************************.5559***************************** PP TIGR01122 138 frraavnsiptkakaagnYlnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvse 206 f+r++vn+++tkak++gnY+ns+lak+ea++ Gydea++Ld +GyvaeG+Gen+f+vkd+v++tPp+ + lcl|NCBI__GCF_900167125.1:WP_078716504.1 146 FTRHHVNVMMTKAKSGGNYVNSVLAKTEAVADGYDEAVMLDPQGYVAEGTGENLFMVKDDVIYTPPL-H 213 *******************************************************************.6 PP TIGR01122 207 siLkgitrdaviklakelgievkeerisreelytaDevfltGtaaevtPirevDgrkigegkrGpvtkk 275 ++L g trd+vi+la +lg+ev+e +++r++ly+aDevf+tGtaae+tP+revD r igegk+Gpv k lcl|NCBI__GCF_900167125.1:WP_078716504.1 214 NVLGGFTRDSVITLAGDLGYEVREITMGRDMLYIADEVFFTGTAAEITPVREVDRRVIGEGKAGPVAKL 282 6******************************************************************** PP TIGR01122 276 lqeaffdlvegktekkeewlt 296 lq++ff++v+g++++++ wl+ lcl|NCBI__GCF_900167125.1:WP_078716504.1 283 LQTEFFRIVKGENPDYALWLH 303 *******************97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (307 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.61 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory