Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EC 4.2.3.5 (characterized)
to candidate WP_084275155.1 B8779_RS03370 chorismate synthase
Query= SwissProt::P56122 (365 letters) >NCBI__GCF_900176045.1:WP_084275155.1 Length = 358 Score = 442 bits (1137), Expect = e-129 Identities = 219/363 (60%), Positives = 280/363 (77%), Gaps = 6/363 (1%) Query: 1 MNTLGRFLRLTTFGESHGDVIGGVLDGMPSGIKIDYALLENEMKRRQGGRNVFITPRKED 60 MN+ G R TTFGESHG IG V+DG+P+G+KID +++E+ RR+ G++ F T RKE Sbjct: 1 MNSFGIKFRFTTFGESHGKAIGCVVDGVPAGLKIDEEFIQSELDRRRPGKSKFATARKES 60 Query: 61 DKVEITSGVFEDFSTGTPIGFLIHNQRARSKDYDNIKNLFRPSHADFTYFHKYGIRDFRG 120 DKVEI SGVFE +TGTPI +I N+ +S+DY NIK++FRP HADFTY++KYGIRD+RG Sbjct: 61 DKVEILSGVFEGKATGTPIAMVIFNKDQKSRDYSNIKDIFRPGHADFTYYYKYGIRDYRG 120 Query: 121 GGRSSARESAIRVAAGAFAKMLLREIGIVCESGIIEIGGIKAKNYDFNHALKSEIFALDE 180 GGRSSARE+A RVA GA AK+ L+E GI E+G++E+ GIKAK DF +A +SEIFALD Sbjct: 121 GGRSSARETAARVATGAVAKLFLKEFGIEVEAGVVEVAGIKAKKLDFKYARESEIFALDP 180 Query: 181 EQEEAQKTAIQNAIKNHDSIGGVALIRARSIKTNQKLPIGLGQGLYAKLDAKIAEAMMGL 240 EE QK AI A + HDS+GG L+RAR + P+GLG+ +Y KLDA +AEA+M + Sbjct: 181 SVEEQQKEAILGAKEAHDSVGGAVLVRARGV------PVGLGEPIYYKLDAVLAEALMSI 234 Query: 241 NGVKAVEIGKGVESSLLKGSEYNDLMDQKGFLSNRSGGVLGGMSNGEEIIVRVHFKPTPS 300 N KAVEIG G E+S L GS+ ND + +GF+SN +GG+LGG+SNGEE+I +V+FKPTPS Sbjct: 235 NAAKAVEIGNGCEASRLLGSQNNDEITAEGFVSNNAGGILGGISNGEEVIAKVYFKPTPS 294 Query: 301 IFQPQRTIDINGNECECLLKGRHDPCIAIRGSVVCESLLALVLADMVLLNLTSKIEYLKT 360 IFQ QR+IDI+GNE E LKGRHDP +A RGSVV E+++ALVLADM+LLN TSK+E L+ Sbjct: 295 IFQKQRSIDIDGNEVEVELKGRHDPFVAARGSVVAEAMMALVLADMLLLNATSKLENLQK 354 Query: 361 IYN 363 IYN Sbjct: 355 IYN 357 Lambda K H 0.319 0.139 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 424 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 358 Length adjustment: 29 Effective length of query: 336 Effective length of database: 329 Effective search space: 110544 Effective search space used: 110544 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_084275155.1 B8779_RS03370 (chorismate synthase)
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00033.hmm # target sequence database: /tmp/gapView.21037.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00033 [M=351] Accession: TIGR00033 Description: aroC: chorismate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-135 437.6 0.9 1.7e-135 437.4 0.9 1.0 1 lcl|NCBI__GCF_900176045.1:WP_084275155.1 B8779_RS03370 chorismate synthas Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900176045.1:WP_084275155.1 B8779_RS03370 chorismate synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 437.4 0.9 1.7e-135 1.7e-135 1 348 [. 8 345 .. 8 348 .. 0.97 Alignments for each domain: == domain 1 score: 437.4 bits; conditional E-value: 1.7e-135 TIGR00033 1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtG 69 +r+ttfGeSHgka+g+++dG+Pagl+++ee iq+el+rRrpg+s++++ rkE+D+veilsGvfeGk tG lcl|NCBI__GCF_900176045.1:WP_084275155.1 8 FRFTTFGESHGKAIGCVVDGVPAGLKIDEEFIQSELDRRRPGKSKFATARKESDKVEILSGVFEGKATG 76 89******************************************************************* PP TIGR00033 70 aPiallikNkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLke 138 +Pia++i Nkd++s+dy++ik+++RPgHad+ty KYgi+d++gggrsSaReTaarva+Gavak +Lke lcl|NCBI__GCF_900176045.1:WP_084275155.1 77 TPIAMVIFNKDQKSRDYSNIKDIFRPGHADFTYYYKYGIRDYRGGGRSSARETAARVATGAVAKLFLKE 145 ********************************************************************* PP TIGR00033 139 tagieivayvvklgeveleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvv 207 gie+ a vv+++ +++++ +k + +s+++++d++ e++ +e i ak+++dsvGg v v + lcl|NCBI__GCF_900176045.1:WP_084275155.1 146 -FGIEVEAGVVEVAGIKAKKLDFK-----YARESEIFALDPSVEEQQKEAILGAKEAHDSVGGAVLVRA 208 .88**************9975554.....466799********************************** PP TIGR00033 208 snvpvglGeplfdkldaelasallsinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGi 276 ++vpvglGep++ klda la+al+sinA+K+veiG+G ea + Gs+ nDe+++e +++nn GGi lcl|NCBI__GCF_900176045.1:WP_084275155.1 209 RGVPVGLGEPIYYKLDAVLAEALMSINAAKAVEIGNGCEASRLLGSQNNDEITAE----GFVSNNAGGI 273 **************************************************99887....699******* PP TIGR00033 277 eGGitnGedirvriavKpiptikkplktvdletkekakatkgRhDpcvvpravpvvEamvalvladall 345 +GGi+nGe++ ++ +Kp+p+i ++++++d++++e kgRhDp v+ r ++v+Eam+alvlad+ll lcl|NCBI__GCF_900176045.1:WP_084275155.1 274 LGGISNGEEVIAKVYFKPTPSIFQKQRSIDIDGNEVEVELKGRHDPFVAARGSVVAEAMMALVLADMLL 342 **********************************999999***************************98 PP TIGR00033 346 ekr 348 + lcl|NCBI__GCF_900176045.1:WP_084275155.1 343 LNA 345 765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.97 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory