Align Homoserine kinase; HK; HSK; EC 2.7.1.39 (uncharacterized)
to candidate WP_084275346.1 B8779_RS04430 homoserine kinase
Query= curated2:A8EWD5 (293 letters) >NCBI__GCF_900176045.1:WP_084275346.1 Length = 293 Score = 362 bits (928), Expect = e-105 Identities = 183/292 (62%), Positives = 229/292 (78%) Query: 1 MKVSVPATSANLGPGFDCLGLAVSLKNQVIIRPSKFHSVSLKGEGANNPALKDNNMFISI 60 M +SVPATSANLGPGFD LG+A+ L+N+V I+ S+F S+S+KGEG+ + LK NN+FISI Sbjct: 1 MFISVPATSANLGPGFDTLGVALDLRNEVSIKRSRFFSISIKGEGSKSFRLKGNNIFISI 60 Query: 61 FNDFYQNLSHKKRFFRFEFQNEIPLSRGLGSSSAVIVSAIASAYAIEGIKLERDKLLNLA 120 FN+ Y+NL KK FRF F N+IPLSRGLGSSSAVIVSAIA+AYA+ GI L +LL+LA Sbjct: 61 FNEHYRNLVDKKEKFRFTFYNKIPLSRGLGSSSAVIVSAIAAAYAMAGIPLSSQRLLSLA 120 Query: 121 LAYESHPDNITPAVMGGFNVACVQENEVKYINKPIPKSLKAVIVVPNRAISTAMSRKTLP 180 L+YE HPDNITPAVMGGFN A V+ + V I K +P++LKAVIV+PNR IST+ SR LP Sbjct: 121 LSYEPHPDNITPAVMGGFNAAVVENSRVYSIKKEMPQNLKAVIVIPNRPISTSHSRTKLP 180 Query: 181 FKYSKEDTIFNISHSSLLTAAFMSENWEMLKYASNDQVHQKYRMKQMPELFEVQKTALKE 240 K S D +FNISHSSLLTAA +E W++L+ AS D++HQ RM+ MPELFEVQK AL+ Sbjct: 181 RKLSLSDAVFNISHSSLLTAAIFNEEWDLLRIASKDKLHQDIRMRAMPELFEVQKLALQN 240 Query: 241 GALMSTLSGSGSTLFSMAYTDDSRNLEKALKNKFPHFRVFVVDFDNTGVKIE 292 GALMSTLSGSGST F+M Y +D++ L L+N+F F + ++DFDN G+ IE Sbjct: 241 GALMSTLSGSGSTFFNMVYAEDAKPLAYKLQNRFSKFAIKILDFDNQGIIIE 292 Lambda K H 0.318 0.132 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 293 Length of database: 293 Length adjustment: 26 Effective length of query: 267 Effective length of database: 267 Effective search space: 71289 Effective search space used: 71289 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate WP_084275346.1 B8779_RS04430 (homoserine kinase)
to HMM TIGR00191 (thrB: homoserine kinase (EC 2.7.1.39))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00191.hmm # target sequence database: /tmp/gapView.25764.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00191 [M=304] Accession: TIGR00191 Description: thrB: homoserine kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-87 276.9 0.0 8.4e-87 276.8 0.0 1.0 1 lcl|NCBI__GCF_900176045.1:WP_084275346.1 B8779_RS04430 homoserine kinase Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900176045.1:WP_084275346.1 B8779_RS04430 homoserine kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 276.8 0.0 8.4e-87 8.4e-87 3 302 .. 3 292 .. 1 293 [] 0.95 Alignments for each domain: == domain 1 score: 276.8 bits; conditional E-value: 8.4e-87 TIGR00191 3 vkvPassANlgpGfDvlGlalslvlellvtedvaqeskdksleaegegvekipkesdkNliyqvakkvl 71 ++vPa+sANlgpGfD+lG+al l++e+ ++ + + + + ++geg + ++ +N++ ++++ + lcl|NCBI__GCF_900176045.1:WP_084275346.1 3 ISVPATSANLGPGFDTLGVALDLRNEVSIKR----SRFFS-ISIKGEGSKSFRLK-GNNIFISIFNEHY 65 89***************************99....66665.99999998888888.9************ PP TIGR00191 72 kklgkrvkpvkltvekeiplgrGLGSSaaaivaaviaanelaglklskeelldlalllEgHpDNvapal 140 ++l + + +++t ++ipl+rGLGSS+a iv+a++aa ++ag +ls ++ll lal +E HpDN++pa+ lcl|NCBI__GCF_900176045.1:WP_084275346.1 66 RNLVDKKEKFRFTFYNKIPLSRGLGSSSAVIVSAIAAAYAMAGIPLSSQRLLSLALSYEPHPDNITPAV 134 **99999************************************************************** PP TIGR00191 141 lGGlqlavkedd..llevlkvPsgsklkvvlviPnievsTaeaRavLPkaysrqdlvfnlshlavlvtA 207 +GG+++av e+ +++ ++P ++lk+v+viPn+ +sT +R LP++ s++d+vfn sh+++l++A lcl|NCBI__GCF_900176045.1:WP_084275346.1 135 MGGFNAAVVENSrvYSIKKEMP--QNLKAVIVIPNRPISTSHSRTKLPRKLSLSDAVFNISHSSLLTAA 201 ***********96667777788..8******************************************** PP TIGR00191 208 lvskdkadllaiamkDrvhqpyRekliPelteikqaakekgalgitlSGaGptilalaeeekeekaqel 276 + ++ ++dll+ia+kD++hq R++ +Pel+e+++ a ++gal++tlSG+G+t++++ + e+ a+ l lcl|NCBI__GCF_900176045.1:WP_084275346.1 202 IFNE-EWDLLRIASKDKLHQDIRMRAMPELFEVQKLALQNGALMSTLSGSGSTFFNMVYAED---AKPL 266 ****.*******************************************************99...7788 PP TIGR00191 277 leklakegieltvkvleldtdgaeve 302 kl++ + ++ +k+l++d++g +e lcl|NCBI__GCF_900176045.1:WP_084275346.1 267 AYKLQNRFSKFAIKILDFDNQGIIIE 292 88999999*************98776 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (304 nodes) Target sequences: 1 (293 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 10.38 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory