Align Valine--pyruvate aminotransferase; Alanine--valine transaminase; EC 2.6.1.66 (characterized)
to candidate WP_084276163.1 B8779_RS08365 aminotransferase
Query= SwissProt::P96847 (388 letters) >NCBI__GCF_900176045.1:WP_084276163.1 Length = 370 Score = 225 bits (574), Expect = 1e-63 Identities = 132/373 (35%), Positives = 203/373 (54%), Gaps = 12/373 (3%) Query: 13 PFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPE 72 PF VM A A+ + D ++ G+P P V AA AL + Y+++ G+P Sbjct: 9 PFMVM----AIAKEASKYKDAIHFEIGEPDLPPPPGVVEAAKCALDNYRFSYTISEGLPA 64 Query: 73 LRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNIL 132 LR IA YQ+R+ + + P+ ++IT G+SG F+LA+ D G+ +A + PGYP Y+N Sbjct: 65 LRQKIADFYQKRYSVFINPENILITPGTSGAFMLAYALTLDFGNSLAFSDPGYPSYKNFA 124 Query: 133 SALGCEVVEIPCGPQTRFQPTAQMLAEIDPPLRGVVVASPANPTGTVIPPEELAAIASWC 192 LG E IP T + T + L + P + +++PANP+G V + L + ++C Sbjct: 125 YILGIEPRFIPVDSLTSYCITPEHLHKNRP--HALQISNPANPSGNVYEIDLLKDLCTYC 182 Query: 193 DASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVL 252 ++ LISDE+YHGL+Y T+ A+ + A+V+N FSKY+ M G R+GW++VP+ L Sbjct: 183 LHKNIILISDELYHGLIYDANTTTALAF--NEEAIVINGFSKYFCMPGMRIGWIIVPSKL 240 Query: 253 RRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGIDR 312 R+ + N I P LSQ AA+ AF E A +Y R L L ++ Sbjct: 241 RKKAVEIAQNIFIAAPTLSQYAALEAFDEEYLASV---TLTYRKRRDYLYQELSKLFYIP 297 Query: 313 LAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGPSG 372 P GAFY++AD+S ++ ++L F LL T VAI PGIDF FVR ++ Sbjct: 298 QKP-QGAFYIWADISKYSDNALHFAHDLLQKTHVAITPGIDFGYNNTQKFVRFAYTKSIE 356 Query: 373 DIEEALRRIGSWL 385 +E+ ++R+ S+L Sbjct: 357 QMEQGVKRLKSFL 369 Lambda K H 0.321 0.136 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 378 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 388 Length of database: 370 Length adjustment: 30 Effective length of query: 358 Effective length of database: 340 Effective search space: 121720 Effective search space used: 121720 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory