Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); 3-dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate WP_084057311.1 B9A12_RS07665 shikimate dehydrogenase
Query= BRENDA::A0A5H2X4C4 (538 letters) >NCBI__GCF_900176285.1:WP_084057311.1 Length = 278 Score = 147 bits (372), Expect = 4e-40 Identities = 95/282 (33%), Positives = 147/282 (52%), Gaps = 19/282 (6%) Query: 254 RSIGPDTKVFGIIGKPVGHSKSPLLYNQAFKSAGFDGVFLHLLVDDVASFLQTYSSTDFA 313 RS+ D ++G++G PV HS SP + N A +L L +D A L+ Sbjct: 3 RSVQHD--LYGVVGNPVRHSLSPAMMNAALVHLAVPAFYLALESEDFAQDLEGLVELGLR 60 Query: 314 GFSCTIPHKEAAVKCCDEVDPVAKSIGAVNCIIRRQSDAKLFGYNTDYVGAISAIEDGLR 373 G S TIPHKE A+ C VD A+ IGAVN + R S+ G NTD++GA+ A++ Sbjct: 61 GLSVTIPHKETALGLCAWVDEAAREIGAVNTL--RWSEKGWEGRNTDWIGAVRALQ---- 114 Query: 374 GSQNGNSAGASPLNGKLFVVIGAGGAGKALGYGAKEKGARVVIANRTYDRARELAETIGG 433 A L G+ +V+GAGGA KA+ YG G +V +ANRT +AR+LA G Sbjct: 115 --------SAVELGGQRALVLGAGGAAKAVIYGLVRSGLQVTVANRTEAKARDLAARFGC 166 Query: 434 DALSLADLENFHPEDGMILANTTSIGMQPKVDETPIPKHALKHYSLVFDAVYTPKITRLL 493 + LA ++ + ++ + T+ G++ + + + + ++V D VY+P T L Sbjct: 167 HWVPLAHMKEVSVD---LVVHCTAGGLRGRSYAFALEEVPFRPGAVVMDIVYSPLDTPFL 223 Query: 494 KEAEECGATIVSGLEMFIGQAYGQYERYTGLPAPKELFRKIM 535 + A GA++V GLEM + Q Q + G PAP+ + R+ + Sbjct: 224 QAARAAGASVVDGLEMLLHQGVEQLSWWLGRPAPESVMRRAL 265 Lambda K H 0.317 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 300 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 538 Length of database: 278 Length adjustment: 30 Effective length of query: 508 Effective length of database: 248 Effective search space: 125984 Effective search space used: 125984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory