Align aspartate-semialdehyde dehydrogenase (EC 1.2.1.11) (characterized)
to candidate WP_089301949.1 CHB84_RS13520 aspartate-semialdehyde dehydrogenase
Query= BRENDA::P9WNX5 (345 letters) >NCBI__GCF_900188115.1:WP_089301949.1 Length = 346 Score = 454 bits (1168), Expect = e-132 Identities = 239/344 (69%), Positives = 270/344 (78%), Gaps = 1/344 (0%) Query: 2 GLSIGIVGATGQVGQVMRTLLDERDFPASAVRFFASARSQGRKLAFRGQEIEVEDAETAD 61 G+ IGIVGATGQVG VMR +L ERDFP + +R+FAS+RS G L +R E+ VED TAD Sbjct: 4 GVRIGIVGATGQVGGVMRGILAERDFPVAEMRYFASSRSAGTSLPWRDSEVTVEDVATAD 63 Query: 62 PSGLDIALFSAGSAMSKVQAPRFAAAGVTVIDNSSAWRKDPDVPLVVSEVNFERDAHRRP 121 PSGLDIALFSAG + SK QA RFA AG VIDNSSAWR DP+VPLVVSEVN + R Sbjct: 64 PSGLDIALFSAGGSTSKAQAQRFADAGAIVIDNSSAWRLDPEVPLVVSEVNPQAIKEAR- 122 Query: 122 KGIIANPNCTTMAAMPVLKVLHDEARLVRLVVSSYQAVSGSGLAGVAELAEQARAVIGGA 181 +GIIANPNCTTMAAMPVLK LHDEA L RL+ S+YQAVSGSGLAGV EL Q RA A Sbjct: 123 RGIIANPNCTTMAAMPVLKPLHDEAGLARLIASTYQAVSGSGLAGVEELGAQLRAAGDRA 182 Query: 182 EQLVYDGGALEFPPPNTYVAPIAFNVVPLAGSLVDDGSGETDEDQKLRFESRKILGIPDL 241 +L +DG A++ P Y PIAFNV+ +AGSLVDDGS ETDE+QKLR ESRKILGIPDL Sbjct: 183 TELAHDGRAVQLGEPEKYARPIAFNVLAMAGSLVDDGSAETDEEQKLRNESRKILGIPDL 242 Query: 242 LVSGTCVRVPVFTGHSLSINAEFAQPLSPERARELLDGATGVQLVDVPTPLAAAGVDESL 301 VSGTCVRVPVFTGHSLSINAEF +P++PERA E+L GA GV + ++PTPL AAG D S Sbjct: 243 RVSGTCVRVPVFTGHSLSINAEFERPITPERAYEVLSGAAGVAVAEIPTPLEAAGTDPSY 302 Query: 302 VGRIRRDPGVPDGRGLALFVSGDNLRKGAALNTIQIAELLTADL 345 VGRIR D GV GRGLALFVS DNLRKGAALNT+Q+AEL+ L Sbjct: 303 VGRIRTDDGVDGGRGLALFVSNDNLRKGAALNTVQLAELVAETL 346 Lambda K H 0.317 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 346 Length adjustment: 29 Effective length of query: 316 Effective length of database: 317 Effective search space: 100172 Effective search space used: 100172 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate WP_089301949.1 CHB84_RS13520 (aspartate-semialdehyde dehydrogenase)
to HMM TIGR01296 (asd: aspartate-semialdehyde dehydrogenase (EC 1.2.1.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01296.hmm # target sequence database: /tmp/gapView.14872.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01296 [M=339] Accession: TIGR01296 Description: asd_B: aspartate-semialdehyde dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-136 441.2 0.0 1.4e-136 441.0 0.0 1.0 1 lcl|NCBI__GCF_900188115.1:WP_089301949.1 CHB84_RS13520 aspartate-semialde Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900188115.1:WP_089301949.1 CHB84_RS13520 aspartate-semialdehyde dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 441.0 0.0 1.4e-136 1.4e-136 1 336 [. 6 342 .. 6 345 .. 0.97 Alignments for each domain: == domain 1 score: 441.0 bits; conditional E-value: 1.4e-136 TIGR01296 1 nvaivGatGavGqellkvLeernfpidklvllasersaGkkvkfkgkeleveeaekesfegidialfsa 69 +++ivGatG+vG +++ +L+er+fp+ +++ +as+rsaG+ + ++ e++ve++ +++++g+dialfsa lcl|NCBI__GCF_900188115.1:WP_089301949.1 6 RIGIVGATGQVGGVMRGILAERDFPVAEMRYFASSRSAGTSLPWRDSEVTVEDVATADPSGLDIALFSA 74 599****************************************************************** PP TIGR01296 70 GgsvskefapkaakagviviDntsafrldedvPLvvpevnaeelkeakkkgiianPnCstiqlvvvLkp 138 Ggs+sk++a ++a ag+iviDn+sa+rld++vPLvv+evn + +kea+ +giianPnC+t+++++vLkp lcl|NCBI__GCF_900188115.1:WP_089301949.1 75 GGSTSKAQAQRFADAGAIVIDNSSAWRLDPEVPLVVSEVNPQAIKEAR-RGIIANPNCTTMAAMPVLKP 142 ************************************************.******************** PP TIGR01296 139 lkdeaklkrvvvstYqavsGaGkkgveeLknqtkavlegkekepeida....lkakkfakqiafnaipl 203 l+dea+l r++ stYqavsG+G +gveeL q++a+ + + + ++++ +++k+a++iafn++++ lcl|NCBI__GCF_900188115.1:WP_089301949.1 143 LHDEAGLARLIASTYQAVSGSGLAGVEELGAQLRAAGDRATELAHDGRavqlGEPEKYARPIAFNVLAM 211 ***********************************99988777777633555789************** PP TIGR01296 204 idklkedG..ytkeelkllfetrkilgiedlkvsatcvrvPvftghsesvsiefekelsveevkelLke 270 +++l++dG +t+ee+kl++e+rkilgi+dl+vs+tcvrvPvftghs+s+++efe+++++e+++e+L + lcl|NCBI__GCF_900188115.1:WP_089301949.1 212 AGSLVDDGsaETDEEQKLRNESRKILGIPDLRVSGTCVRVPVFTGHSLSINAEFERPITPERAYEVLSG 280 ********999********************************************************** PP TIGR01296 271 apgvvviddpsenlyptPleavgkdevfvgrirkD..lskekglalfvvaDnlrkGaalnavqiaell 336 a gv+v + p tPlea+g+d ++vgrir D ++ ++glalfv+ DnlrkGaaln+vq+ael+ lcl|NCBI__GCF_900188115.1:WP_089301949.1 281 AAGVAVAEIP------TPLEAAGTDPSYVGRIRTDdgVDGGRGLALFVSNDNLRKGAALNTVQLAELV 342 ******9998......******************999999*************************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (339 nodes) Target sequences: 1 (346 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.45 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory