Align ketol-acid reductoisomerase (NADP+) (EC 1.1.1.86) (characterized)
to candidate WP_089299961.1 CHB84_RS03215 ketol-acid reductoisomerase
Query= BRENDA::A0A0K2AZ61 (332 letters) >NCBI__GCF_900188115.1:WP_089299961.1 Length = 330 Score = 464 bits (1193), Expect = e-135 Identities = 225/326 (69%), Positives = 266/326 (81%) Query: 3 ELFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDSGVDVRVGLHEGSKSKAKAEEQGL 62 E+FYD DADL +IQ RKVA+IGYGSQGHAHALSLRDSGVDVRVGL E SKS+ KA ++GL Sbjct: 4 EMFYDDDADLGLIQARKVAIIGYGSQGHAHALSLRDSGVDVRVGLPESSKSRTKAADEGL 63 Query: 63 RVVSPSEAAAEADVIMILVPDPIQAQVYEEHIKDNLKDGDALFFGHGLNIRFGFIKPPAG 122 RVV+P+EAA EAD+IMIL PD Q +Y I +L+ GDAL+FGHG NIR+G I+PPA Sbjct: 64 RVVTPAEAAQEADLIMILAPDTAQRSIYANDIAPHLRSGDALYFGHGFNIRYGLIQPPAD 123 Query: 123 VDVCMVAPKGPGHLVRRQYEEGRGVPCIAAVEQDASGNAFALALSYAKGIGGTRAGVIKT 182 VDV MVAPKGPGHLVRRQ+ +GRGVPC+ AVEQD SG+A ALALSYAKGIGG RAGVI+T Sbjct: 124 VDVAMVAPKGPGHLVRRQFVDGRGVPCLIAVEQDPSGSAQALALSYAKGIGGARAGVIRT 183 Query: 183 TFTEETETDLFGEQAVLCGGTAALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMYEG 242 TF EETETDLFGEQAVLCGGT+AL++ FE LTEAGY PEIAYFE LHELKLIVDLMYEG Sbjct: 184 TFAEETETDLFGEQAVLCGGTSALIQNAFEVLTEAGYAPEIAYFEVLHELKLIVDLMYEG 243 Query: 243 GLEKMRWSISETAEWGDYVTGPRIITDATKAEMKKVLAEIQDGTFAKNWMDEYHGGLKKY 302 G+ R+S+S+TA +GD GPR+IT A K EM+KVLAE+QDG+FA+ W+ E G Y Sbjct: 244 GIAGQRYSVSDTATYGDLTRGPRVITPAVKEEMRKVLAEVQDGSFAREWVAEDEAGRPNY 303 Query: 303 NEYKQQDSEHLLETTGKQLRKLMSWV 328 + +Q+ + H +E G +LRKLM+WV Sbjct: 304 TKLEQEGASHPIEEVGSRLRKLMAWV 329 Lambda K H 0.316 0.135 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 332 Length of database: 330 Length adjustment: 28 Effective length of query: 304 Effective length of database: 302 Effective search space: 91808 Effective search space used: 91808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate WP_089299961.1 CHB84_RS03215 (ketol-acid reductoisomerase)
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.17702.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-132 427.7 0.0 1.3e-132 427.5 0.0 1.0 1 lcl|NCBI__GCF_900188115.1:WP_089299961.1 CHB84_RS03215 ketol-acid reducto Domain annotation for each sequence (and alignments): >> lcl|NCBI__GCF_900188115.1:WP_089299961.1 CHB84_RS03215 ketol-acid reductoisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 427.5 0.0 1.3e-132 1.3e-132 2 312 .. 17 328 .. 16 330 .] 0.99 Alignments for each domain: == domain 1 score: 427.5 bits; conditional E-value: 1.3e-132 TIGR00465 2 kgkkvaiiGyGsqGeaqalnlrdsglnvivglrkeaaswkkAeedGfkvltveeaikkadlimiLlpDe 70 + +kvaiiGyGsqG+a+al lrdsg++v+vgl ++++s +kA ++G++v+t +ea+++adlimiL pD+ lcl|NCBI__GCF_900188115.1:WP_089299961.1 17 QARKVAIIGYGSQGHAHALSLRDSGVDVRVGLPESSKSRTKAADEGLRVVTPAEAAQEADLIMILAPDT 85 789****************************************************************** PP TIGR00465 71 vqkevyeaeikpllkegkallfsHGfnivfkqivipkdvdvvlvAPKgpGalvReeykegrGvpsliAv 139 +q++ y ++i+p l+ g+al+f HGfni + i++p+dvdv++vAPKgpG+lvR+++ grGvp liAv lcl|NCBI__GCF_900188115.1:WP_089299961.1 86 AQRSIYANDIAPHLRSGDALYFGHGFNIRYGLIQPPADVDVAMVAPKGPGHLVRRQFVDGRGVPCLIAV 154 ********************************************************************* PP TIGR00465 140 eqdvtgeakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqpe 208 eqd++g a++ Al+yAk+iGgaragv+ ttF eE+e+DLfGEqavLcGg +ali+ af++L+eaGy+pe lcl|NCBI__GCF_900188115.1:WP_089299961.1 155 EQDPSGSAQALALSYAKGIGGARAGVIRTTFAEETETDLFGEQAVLCGGTSALIQNAFEVLTEAGYAPE 223 ********************************************************************* PP TIGR00465 209 lAyfeivhelklivdllkekGlelmrdavsntAklgalelr.eilkeelkkemqkilkeiqnGefakew 276 +Ayfe++helklivdl++e+G+++ r +vs+tA +g+l+++ ++++ ++k+em+k+l e+q+G+fa+ew lcl|NCBI__GCF_900188115.1:WP_089299961.1 224 IAYFEVLHELKLIVDLMYEGGIAGQRYSVSDTATYGDLTRGpRVITPAVKEEMRKVLAEVQDGSFAREW 292 ********************************************************************* PP TIGR00465 277 alekeagkpafeearkkekeqeiekvGkelralvka 312 + e+eag+p++++ ++ + ie+vG++lr+l+ + lcl|NCBI__GCF_900188115.1:WP_089299961.1 293 VAEDEAGRPNYTKLEQEGASHPIEEVGSRLRKLMAW 328 *********************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (330 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.69 // [ok]
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory