Align Homocysteine formation from aspartate semialdehyde (DUF39 component) (characterized)
to candidate WP_089323239.1 CHB58_RS06170 hypothetical protein
Query= reanno::Miya:8500721 (390 letters) >NCBI__GCF_900188395.1:WP_089323239.1 Length = 403 Score = 450 bits (1158), Expect = e-131 Identities = 216/387 (55%), Positives = 282/387 (72%), Gaps = 2/387 (0%) Query: 4 FKVNKTIAEINERIRQGKAVVLNAEEMTEAVRRMGKEKAAREIDVVTTGTFSPMCSSGLL 63 FKVNKT EINE+IR+G+ VV+ AEEM E V G KAA E+DVVTTGTF MCSSG Sbjct: 5 FKVNKTYEEINEKIRKGEVVVVTAEEMIEIVEEKGVVKAAEEVDVVTTGTFGAMCSSGAF 64 Query: 64 FNIGQQDPPTLKTAKVWMNDVPAYAGLAAVDSYLGATEPTEDDPLNKVYPGRFKYGGGHV 123 N+G P +K ++++N VPAY GLAAVD Y+GAT E+DP N+VYPG+F+YGG HV Sbjct: 65 LNVGHTKPK-MKMEEIYLNGVPAYGGLAAVDLYIGATALPENDPRNEVYPGKFEYGGAHV 123 Query: 124 IEDLVRGKAVHLRAEAYGTDCYPRKSLDKKITLSELPYAHLLNPRNCYQNYNAAVNLTSR 183 IE+L+ G+ + L A YGTDCYPR+ + K I ++ + A LLNPRNCYQNYN AVN +SR Sbjct: 124 IEELIAGEDIELEAYGYGTDCYPRREIKKIININTVRDAILLNPRNCYQNYNVAVNKSSR 183 Query: 184 IIYTYMGPLKPNLRNVNFATAGRISPLFNDPLFRTIGLGTRIFLGGGTGYVLGAGTQHVA 243 IYTYMG LKPNL N +++AG++SPL NDP F TIG+GTRIFLGGG GY+ GTQH Sbjct: 184 TIYTYMGVLKPNLSNATYSSAGQLSPLLNDPFFETIGIGTRIFLGGGVGYIAFHGTQHAP 243 Query: 244 APKRTERGLPLSPAGTLMLKGDLKGMNARYLRGLSFLGYGCSLAVGVGIPIPILNEEIAW 303 KR ERG+PL+ +GT+M GD+KGM+ ++R S +GYG SL VG+GIPIP+LNE IA+ Sbjct: 244 NVKRNERGIPLAGSGTIMTVGDMKGMSTEFIRAASIVGYGVSLFVGIGIPIPVLNERIAF 303 Query: 304 FTGVDDSDIQMPVKDYGHDYPNC-LPRVIQHVTYEDLKSGEVEIMGKKVETVPMTSYPLS 362 +T V DS+I PV DY HDYP+ + +V+Y DL+ G +E+ GKK+ P++SY + Sbjct: 304 YTSVKDSEIFAPVFDYSHDYPSGESVEPLAYVSYADLRKGFIEVEGKKIPASPLSSYYKA 363 Query: 363 LEVANTLKSWIEKGEFLLTEPVELLPS 389 E+A LK WIE+G+F +++P + LP+ Sbjct: 364 REIAQILKEWIEEGKFEISKPAQTLPA 390 Lambda K H 0.318 0.137 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 546 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 403 Length adjustment: 31 Effective length of query: 359 Effective length of database: 372 Effective search space: 133548 Effective search space used: 133548 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 10 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory