Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate N515DRAFT_4305 N515DRAFT_4305 cystathionine gamma-lyase
Query= BRENDA::Q5H4T8 (397 letters) >FitnessBrowser__Dyella79:N515DRAFT_4305 Length = 392 Score = 571 bits (1471), Expect = e-167 Identities = 274/383 (71%), Positives = 322/383 (84%), Gaps = 1/383 (0%) Query: 11 GDRALSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQGFEYSRTHNPTRFAYE 70 G +L L TLAIH GQSPDP+TGA+M PIYATSTY Q SPG+H+G+EYSRT NPTR AYE Sbjct: 10 GQSSLGLGTLAIHAGQSPDPTTGAIMTPIYATSTYVQESPGKHKGYEYSRTQNPTRMAYE 69 Query: 71 RCVAALEGGTRAFAFASGMAATSTVMELLDAGSHVVAMDDLYGGTFRLFERVRRRTAGLD 130 CVAALEGG FAF SG+AA +TV++LLD+GSHV+AMDDLYGG++RLFERVRRR+AGLD Sbjct: 70 ACVAALEGGVAGFAFGSGLAAAATVLDLLDSGSHVIAMDDLYGGSYRLFERVRRRSAGLD 129 Query: 131 FSFVDLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLTVVDNTFAS 190 F+FVDL D A KAA++ +TKM+W ETPTNPMLKLVD+A +A A+KHGL+ VVDNTF S Sbjct: 130 FTFVDLNDAQALKAALKPNTKMIWAETPTNPMLKLVDLAKVAAFAKKHGLILVVDNTFCS 189 Query: 191 PMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSIGGVQGPFD 250 PM+QRP GADLV+HSATKYLNGHSDMVGGI VV ELAE+M FLQNS+G V GPFD Sbjct: 190 PMIQRPFESGADLVLHSATKYLNGHSDMVGGI-VVAREQELAERMGFLQNSVGAVAGPFD 248 Query: 251 SFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLAKRQMSGFG 310 SFLA+RGLKTL LRM+AHCE+AL LAQWLE HP +E+VIYPGL SHPQH LA+RQM GFG Sbjct: 249 SFLAMRGLKTLHLRMKAHCESALELAQWLEKHPEVERVIYPGLKSHPQHALARRQMHGFG 308 Query: 311 GIVSIVLKGGFDAAKRFCEKTELFTLAESLGGVESLVNHPAVMTHASIPVARREQLGISD 370 GI+SI +KGG A+R E+ LF LAESLGGVESL+ HPA+MTHAS+P A R++LGISD Sbjct: 309 GIISIEVKGGLRKARRMLERCHLFALAESLGGVESLIEHPAIMTHASVPPANRKRLGISD 368 Query: 371 ALVRLSVGIEDLGDLRGDLERAL 393 +L+RLSVG+ED+ DLR +L AL Sbjct: 369 SLIRLSVGVEDIADLRSELAEAL 391 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 572 Number of extensions: 21 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 392 Length adjustment: 31 Effective length of query: 366 Effective length of database: 361 Effective search space: 132126 Effective search space used: 132126 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory