Align Acetolactate synthase isozyme 1 small subunit; EC 2.2.1.6; Acetohydroxy-acid synthase I small subunit; AHAS-I; ALS-I (uncharacterized)
to candidate 8501147 DvMF_1882 acetolactate synthase 1 regulatory subunit (RefSeq)
Query= curated2:P0ADG0 (96 letters) >FitnessBrowser__Miya:8501147 Length = 121 Score = 105 bits (263), Expect = 1e-28 Identities = 50/84 (59%), Positives = 62/84 (73%) Query: 9 VILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQDSDKSHIWLLVNDDQRLEQMISQ 68 V L LTV NHPGVM+HVCGLFARRAFNVE ILC P+ + S IWLLV +D+RLEQM+ Q Sbjct: 25 VALRLTVNNHPGVMSHVCGLFARRAFNVEAILCTPVNGGEVSRIWLLVAEDERLEQMVRQ 84 Query: 69 IDKLEDVVKVQRNQSDPTMFNKIA 92 + KL DV+ V+R + F ++A Sbjct: 85 VRKLHDVLDVRRRPAGGEGFARLA 108 Lambda K H 0.324 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 45 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 96 Length of database: 121 Length adjustment: 12 Effective length of query: 84 Effective length of database: 109 Effective search space: 9156 Effective search space used: 9156 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 40 (20.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory