Align LL-diaminopimelate aminotransferase; DAP-AT; DAP-aminotransferase; LL-DAP-aminotransferase; EC 2.6.1.83 (characterized)
to candidate 8500663 DvMF_1411 aminotransferase class I and II (RefSeq)
Query= SwissProt::Q2RK33 (390 letters) >FitnessBrowser__Miya:8500663 Length = 394 Score = 355 bits (911), Expect = e-102 Identities = 163/388 (42%), Positives = 253/388 (65%), Gaps = 3/388 (0%) Query: 1 MQEARRIRELPPYLFARIEKKIAEARERGVDIISLGIGDPDMPTPSHVIDKLVAEAHNPE 60 M + R+ LPPY+FA + + + R + VDI+ LG+G+PD+PTP H++DKLV + Sbjct: 1 MNQFPRMHRLPPYVFATVNELKMQLRRQNVDIVDLGMGNPDIPTPQHIVDKLVEASGKGV 60 Query: 61 NHRYPTSEGLLAFRQAVADWYQRLYGVDLDPRREVVTLIGSKEGIAHISLCYVDPGDINL 120 NHRY S G+ R+A+ DWY R +GV LDP E V +G+KEG++H+SL + PGD+ Sbjct: 61 NHRYSVSRGIPNLRKAICDWYMRRFGVYLDPDTEAVATMGAKEGLSHLSLAMLSPGDVVF 120 Query: 121 VPDPGYPVYNIGTLLAGGESYFMPLTAANGFLPDLGAIPSDVARRAKLMFINYPNNPTGA 180 PDP YP++ ++AG + +P+ F DL + KL+FI+YP+NPT Sbjct: 121 APDPTYPIHTYAPIIAGADVRRIPIGRGRDFFEDLLVATRQTWPQPKLLFISYPHNPTCE 180 Query: 181 VADLKFFQEVVEFARSYDLIVCHDAAYSEITYDGYRAPSFLQAPGAKEVGIEFNSVSKPY 240 +A +FFQ+VV+FA+ + + V HD AY+++ +DG+ PSF+QA GAK+VG+EF S+SK Y Sbjct: 181 IAAPEFFQKVVDFAKEHKIYVIHDFAYADLAFDGHMPPSFMQAEGAKDVGVEFFSMSKSY 240 Query: 241 NMTGWRLGWACGRADVIEALARIKSNIDSGAFQAVQYAGIAALTGPQEGLAEVRRVYQER 300 +M GWR+G+ G D++ AL RIKS +D G FQ +Q A AL GPQE + E+ Y++R Sbjct: 241 SMAGWRVGFCVGNRDLVYALTRIKSYLDYGHFQPIQIAATVALNGPQECVTEIVDTYRKR 300 Query: 301 RDIIVEGFNSLGWHLEKPKATFYVWAPVP---RGYTSASFAEMVLEKAGVIITPGNGYGN 357 RD+++EG GW + PK T +VWA +P R S F++++L++ V ++PG G+G Sbjct: 301 RDVLIEGLGRAGWVVPPPKGTMFVWAQIPEEFRAMGSVEFSKLLLKEGHVAVSPGLGFGA 360 Query: 358 YGEGYFRIALTISKERMQEAIERLRRVL 385 +G+ + R AL ++ R ++A++ +++VL Sbjct: 361 HGDDHVRFALIENEHRTKQAMKGIKKVL 388 Lambda K H 0.320 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 451 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 390 Length of database: 394 Length adjustment: 31 Effective length of query: 359 Effective length of database: 363 Effective search space: 130317 Effective search space used: 130317 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory