Align Phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate GFF2616 PGA1_c26570 putative glyoxylate/hydroxypyruvate reductase A
Query= reanno::SB2B:6938941 (308 letters) >FitnessBrowser__Phaeo:GFF2616 Length = 308 Score = 104 bits (259), Expect = 3e-27 Identities = 77/244 (31%), Positives = 110/244 (45%), Gaps = 2/244 (0%) Query: 65 STFAGVDLLVKPRQRRDYLLTNVRGIFGPLMSEYLFGYLLARQREHDLYKSQQQQKLWLP 124 S +AGV+ +V R L V M E++ G++L D ++ Q W P Sbjct: 67 SLWAGVEKIVGNRTLTMPLCRMVDPGLTAGMVEWVTGHVLRYHLNID--RTIHTQDRWEP 124 Query: 125 GSYKTLQGSELLLLGTGSIAKHLAQTAKHFGMKVAGINRSAKATEGFDEVATLEALPTLM 184 + + +LG G++ + A G V G +RS K+ +G + L + Sbjct: 125 VVPPLAEERPVTVLGLGALGQACASMLATLGFPVTGWSRSKKSIDGITCRHGDDGLRDAL 184 Query: 185 ARADAIASILPSTEATRGILNENILARMKPDAVLFNLGRGDVLDLDALERQLRQHPQQQA 244 A A + +LP T AT LN + LA + A + N GRG ++D DAL L A Sbjct: 185 ATAQIVILLLPDTHATENTLNSDTLALLPKGARIINPGRGPLIDDDALLAALDSGQIGHA 244 Query: 245 VLDVFNQEPLPEDHPIWGLGNVIVTPHIAAPSFPEQVAEIFSSNYHKFLLGETLSHRVNF 304 LDVF EPLP DHP W V VTPHIAA + P A + + N + H+V+ Sbjct: 245 TLDVFRIEPLPMDHPYWAHPRVTVTPHIAAETRPLTAARVIADNIRRGEAEAPFLHQVDR 304 Query: 305 ERGY 308 GY Sbjct: 305 TLGY 308 Lambda K H 0.320 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 308 Length adjustment: 27 Effective length of query: 281 Effective length of database: 281 Effective search space: 78961 Effective search space used: 78961 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory