Align Histidine biosynthesis trifunctional protein; EC 3.5.4.19; EC 3.6.1.31; EC 1.1.1.23 (characterized)
to candidate WP_041100155.1 SUTH_RS14175 histidinol dehydrogenase
Query= SwissProt::P00815 (799 letters) >NCBI__GCF_000828635.1:WP_041100155.1 Length = 431 Score = 231 bits (588), Expect = 8e-65 Identities = 145/409 (35%), Positives = 221/409 (54%), Gaps = 13/409 (3%) Query: 384 IMHLVNPIIENVRDKGNSALLEYTEKFDGVKLSNPV-LNAPFPE--EYFEGLTEEMKEAL 440 I V I++ VR +G++A+LE+T +FD + L P E +GL + AL Sbjct: 30 IEQTVAEILKRVRTEGDAAVLEFTRRFDQLDAGTMAELELPRSELRRALDGLPAAQRSAL 89 Query: 441 DLSIENVRKFHAAQLPTETLEVETQPGVLCSRFPRPIEKVGLYIPGGTAILPSTALMLGV 500 + + + V +H Q E+ G + +++VGLY+PGG A PS+ LM + Sbjct: 90 EAAAKRVSDYHERQ-KLESWSFTEADGTRLGQKVTALDRVGLYVPGGKAAYPSSVLMNAL 148 Query: 501 PAQVAQCKEIVFASPPRKSDGKVSPEVVYVAEKVGASKIVLAGGAQAVAAMAYGTETIPK 560 PA+VA E++ P + G+ + V+ A G ++ GGAQAVAA+AYGT+TIP+ Sbjct: 149 PAKVAGVNELIMVVPTPR--GEKNALVLAAACLAGVDRVFTIGGAQAVAALAYGTQTIPQ 206 Query: 561 VDKILGPGNQFVTAAKMYVQNDTQALCSIDMPAGPSEVLVIADEDADVDFVASDLLSQAE 620 VDKI+GPGN +V AAK V IDM AGPSEVL+IAD A+ D+VA DL +QAE Sbjct: 207 VDKIVGPGNAYVAAAKRRVFGTV----GIDMVAGPSEVLIIADASANPDWVAIDLFAQAE 262 Query: 621 HGIDSQVILVGVNLSEKKIQEIQDAVHNQALQLPRVDIVRKCI-AHSTIVLCDGYEEALE 679 H +Q IL+ + I + ++ +PR +++ + ++ ++EA Sbjct: 263 HDELAQSILLSPDADF--IARVAASIEKLLPTMPRREVIAASLKGRGALIHVADFDEACA 320 Query: 680 MSNQYAPEHLILQIANANDYVKLVDNAGSVFVGAYTPESCGDYSSGTNHTLPTYGYARQY 739 ++N+ APEHL L +A+ + + +AG++FVG Y ES GDY +G NH LPT AR Sbjct: 321 LANRIAPEHLELAVADPAPLAEKIRHAGAIFVGHYASESLGDYCAGPNHVLPTSRSARFS 380 Query: 740 SGANTATFQKFITAQNITPEGLENIGRAVMCVAKKEGLDGHRNAVKIRM 788 S FQK + ++ G + +G +A EGL H A ++R+ Sbjct: 381 SPLGVYDFQKRSSLIEVSQAGAQTLGPIAATLAHGEGLTAHARAAELRI 429 Lambda K H 0.315 0.133 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 656 Number of extensions: 37 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 799 Length of database: 431 Length adjustment: 37 Effective length of query: 762 Effective length of database: 394 Effective search space: 300228 Effective search space used: 300228 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory