Align Bifunctional chorismate mutase/prephenate dehydratase; Chorismate mutase-prephenate dehydratase; P-protein; EC 5.4.99.5; EC 4.2.1.51 (characterized)
to candidate WP_041098943.1 SUTH_RS09880 prephenate dehydratase
Query= SwissProt::P27603 (365 letters) >NCBI__GCF_000828635.1:WP_041098943.1 Length = 360 Score = 349 bits (895), Expect = e-101 Identities = 176/365 (48%), Positives = 247/365 (67%), Gaps = 12/365 (3%) Query: 3 EADQLKALRVRIDSLDERILDLISERARCAQEVARVKTASWPKAEEAVFYRPEREAWVLK 62 ++ +L LR ID++D +L LI+ERA+ A+ + +K + YRPEREA VL+ Sbjct: 4 DSHELGQLRDGIDAIDGDLLRLINERAKLARRIGEIKQGN--------IYRPEREAQVLR 55 Query: 63 HIMELNKGPLDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISK 122 + E N GPL R+ RE+MS+CLALEQPL +AYLGP GT+S++AA KHFG + Sbjct: 56 RVAERNPGPLSAAAAQRIVREVMSACLALEQPLTIAYLGPAGTYSESAARKHFGGAPTLL 115 Query: 123 PMAAIDEVFREVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLV 182 P AID+VFR + +G ++GVVP+ENSTEGA+ +LD L + ICGE+ L IHH+L+ Sbjct: 116 PCPAIDDVFRVIESGNAHYGVVPIENSTEGAIGRSLDLLLSSPLQICGEINLPIHHNLMT 175 Query: 183 GETTKTDRITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGD 242 T D +TRIYSHAQSLAQC +WL+ + P V RV V+SNA+AA+ E +AA+AGD Sbjct: 176 RCATLAD-VTRIYSHAQSLAQCHEWLNRNLPLVPRVPVASNAEAARLAAGEAGAAAVAGD 234 Query: 243 MAAQLYGLSKLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSMRNKPGALHELLMP 302 AA+LY L +A IED P N+TRF+I+ + +G D+TS++ S +N+PGA+++LL P Sbjct: 235 AAAELYALPIIAASIEDDPNNTTRFVIVAEHDAGVSGSDRTSLVCSAQNRPGAVYQLLAP 294 Query: 303 FHSNGIDLTRIETRPSR---SGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGS 359 F NG+ ++R+E+RP+R +W YVF+ID GH +P + LE++ H A +K LGS Sbjct: 295 FADNGVSMSRLESRPARGFGGSRWEYVFYIDIEGHRSEPAVARALEELRHRAGFVKELGS 354 Query: 360 YPKAV 364 YPKAV Sbjct: 355 YPKAV 359 Lambda K H 0.319 0.133 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 360 Length adjustment: 29 Effective length of query: 336 Effective length of database: 331 Effective search space: 111216 Effective search space used: 111216 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory