Align phosphoglycerate dehydrogenase (EC 1.1.1.95) (characterized)
to candidate WP_197539595.1 SUTH_RS14420 D-glycerate dehydrogenase
Query= BRENDA::Q9Z564 (529 letters) >NCBI__GCF_000828635.1:WP_197539595.1 Length = 325 Score = 199 bits (505), Expect = 2e-55 Identities = 119/319 (37%), Positives = 182/319 (57%), Gaps = 9/319 (2%) Query: 4 KPVVLIAEELSPATVDALGPDFEIRHCNGADRA----ELLPAIADVDAILVRSATKVDAE 59 K +L+A E+ P ++ L FE+ N AD L +AD L + V A+ Sbjct: 3 KQKILVAREVFPEVLERLRQHFEVDD-NQADAILGVEGLKVRLADKAGALTAATDPVTAD 61 Query: 60 AVAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIP 119 +AAA LK + VG +N+D++A ++AGVM N P T A+LA L++ATAR +P Sbjct: 62 VIAAAPALKAICNFAVGYNNIDLAACSRAGVMATNTPGVLDDTTADLAWALLMATARRLP 121 Query: 120 QANAALKNGEWKRSKYT---GVELAEKTLGVVGLGRIGALVAQRMSAFGMKVVAYDPYVQ 176 A L+NGEW+ ++ G ++ TLG++G+GRIG VA+R F MKV+ ++ Sbjct: 122 AAERWLRNGEWQGWQFIQWLGSDVHHATLGILGMGRIGQAVARRALGFDMKVIYHNRTRL 181 Query: 177 PA-RAAQMGVKVLSLDELLEVSDFITVHLPKTPETLGLIGDEALRKVKPSVRIVNAARGG 235 PA + + + D LL SDF+ + LP +PE+ IG L +KP+ ++N ARGG Sbjct: 182 PADKEDACRARFVDRDTLLRESDFLVLLLPYSPESHHTIGAAELALMKPTAHLINVARGG 241 Query: 236 IVDEEALYSALKEGRVAGAGLDVYAKEPCTDSPLFEFDQVVATPHLGASTDEAQEKAGIA 295 IVD+EAL SAL++ R+AGAG+DV+ EP + E D V TPH+G+S+ + + Sbjct: 242 IVDDEALISALRQRRLAGAGIDVFEGEPKYNPGFLELDNVALTPHIGSSSRATRMAMAMR 301 Query: 296 VAKSVRLALAGELVPDAVN 314 A ++ AL+G+ P+ +N Sbjct: 302 AADNLIAALSGQRPPNLLN 320 Lambda K H 0.315 0.133 0.362 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 20 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 529 Length of database: 325 Length adjustment: 31 Effective length of query: 498 Effective length of database: 294 Effective search space: 146412 Effective search space used: 146412 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory